KEGG   Bacillus subtilis subsp. subtilis 168: BSU27090
Entry
BSU27090          CDS       T00010                                 
Symbol
aapA
Name
(RefSeq) amino acid permease AapA
  KO
K11737  D-serine/D-alanine/glycine transporter
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU27090 (aapA)
Transporters [BR:bsu02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   BSU27090 (aapA)
SSDB
Motif
Pfam: AA_permease AA_permease_2 Cadherin_C_2
Other DBs
NCBI-GeneID: 937231
NCBI-ProteinID: NP_390587
Pasteur: BG12556
BSORF: BG12556
UniProt: O06005 A0A6M3ZHR5
LinkDB
Position
2766558..2767946
AA seq 462 aa
MIGNSSKDNFGQQQKLSRGLKNRHIQLMAIGGAIGTGLFLGSGKSIHFAGPSILFAYLIT
GVFCFFIMRSLGELLLSNAGYHSFVDFVRDYLGNMAAFITGWTYWFCWISLAMADLTAVG
IYTQYWLPDVPQWLPGLLALIILLIMNLATVKLFGELEFWFALIKVIAILALIVTGILLI
AKGFSAASGPASLNNLWSHGGMFPNGWHGFILSFQMVVFAFVGIELVGLTAGETENPQKV
IPKAINQIPVRILLFYVGALFVIMCIYPWNVLNPNESPFVQVFSAVGIVVAASLINFVVL
TSAASAANSALFSTSRMVYSLAKDHHAPGLLKKLTSSNVPSNALFFSSIAILIGVSLNYL
MPEQVFTLITSVSTICFIFIWGITVICHLKYRKTRQHEAKANKFKMPFYPLSNYLTLAFL
AFILVILALANDTRIALFVTPVWFVLLIILYKVQTRRGHKVK
NT seq 1389 nt   +upstreamnt  +downstreamnt
ttgataggcaattctagcaaagacaattttggccagcaacagaaattgtctagaggcctt
aaaaacaggcatatacaattaatggcgattggaggtgcaatcggtacaggtttattttta
ggttcaggtaaatccatccattttgcaggaccatccattttatttgcttacttgatcacc
ggcgtattttgctttttcattatgcgttcgctcggagaactgctcttatcaaatgcggga
taccactcttttgttgattttgtaagggactatttaggaaacatggcagcatttatcact
gggtggacctactggttctgttggatttccctcgcgatggctgatttaacggcggtcggc
atttatacgcaatattggcttcccgatgtgcctcaatggctgccgggtcttcttgcgctt
attatcctgctgatcatgaaccttgccaccgttaaacttttcggagaattagaattttgg
tttgcattgatcaaagtcattgccatactggctctgatcgtaactggtattctcctgatt
gcgaaaggtttttccgcagcttccggccctgccagcctcaacaacctttggagccacggc
ggcatgttcccaaatggatggcatgggtttatcctatctttccaaatggtcgtcttcgct
ttcgtgggtattgaacttgttggactgacagcaggtgaaacagaaaatccccaaaaagtg
atccctaaagccatcaatcaaattcctgtccggattttacttttttatgttggcgcactt
ttcgtgattatgtgtatctatccttggaatgtgttgaatccaaacgaaagcccatttgtt
caggtcttctctgcagtaggcatcgttgtggctgccagtttgatcaattttgttgtatta
acatcagccgcatcagctgcaaatagcgctttattcagcacaagccgaatggtctattca
cttgcaaaggatcatcacgcacctggactattaaagaaattaacttcttctaacgtgcca
agcaatgcgctgttcttttcatccatcgccattctgattggcgttagtctgaattattta
atgcccgagcaagtcttcacgctgattacaagtgtttcaacaatatgcttcatttttatt
tggggcatcacggtgatttgccatttgaaatatcgaaaaacaaggcagcatgaagcgaaa
gcaaacaaatttaaaatgcctttttacccattatccaactatttaacacttgcatttctc
gcgttcattcttgtcatattggcactggcgaatgatacacgtattgctttgtttgtcacc
ccggtctggtttgttttattgattattttgtataaggtgcaaacccgcagaggacataag
gtgaaataa

DBGET integrated database retrieval system