KEGG   Bacillus subtilis subsp. subtilis 168: BSU27650Help
Entry
BSU27650          CDS       T00010                                 

Gene name
secDF
Definition
(RefSeq) protein translocase subunit SecDF
  KO
K12257  SecD/SecF fusion protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02024  Quorum sensing
bsu03060  Protein export
bsu03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    BSU27650 (secDF)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BSU27650 (secDF)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BSU27650 (secDF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bsu02044]
    BSU27650 (secDF)
Secretion system [BR:bsu02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   BSU27650 (secDF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SecD_SecF ACR_tran MMPL Sec_GG
Motif
Other DBs
NCBI-GeneID: 937938
NCBI-ProteinID: NP_390643
Pasteur: BG12672
BSORF: BG12672
UniProt: O32047
LinkDB All DBs
Position
complement(2826900..2829113)
Genome map
AA seq 737 aa AA seqDB search
MKKGRLIAFFLFVLLIGTGLGYFTKPAANNITLGLDLQGGFEVLYDVQPVKKGDKITKDV
LVSTVEALNRRANVLGVSEPNIQIEGNNRIRVQLAGVTNQNRAREILATEAQLSFRDAND
KELLNGADLVENGAKQTYDSTTNEPIVTIKLKDADKFGEVTKKVMKMAPNNQLVIWLDYD
KGDSFKKEVQKEHPKFVSAPNVSQELNTTDVKIEGHFTAQEAKDLASILNAGALPVKLTE
KYSTSVGAQFGQQALHDTVFAGIVGIAIIFLFMLFYYRLPGLIAVITLSVYIYITLQIFD
WMNAVLTLPGIAALILGVGMAVDANIITYERIKEELKLGKSVRSAFRSGNRRSFATIFDA
NITTIIAAVVLFIFGTSSVKGFATMLILSILTSFITAVFLSRFLLALLVESRWLDRKKGW
FGVNKKHIMDIQDTDENTEPHTPFQKWDFTSKRKYFFIFSSAVTVAGIIILLVFRLNLGI
DFASGARIEVQSDHKLTTEQVEKDFESLGMDPDTVVLSGEKSNIGVARFVGVPDKETIAK
VKTYFKDKYGSDPNVSTVSPTVGKELARNALYAVAIASIGIIIYVSIRFEYKMAIAAIAS
LLYDAFFIVTFFSITRLEVDVTFIAAILTIIGYSINDTIVTFDRVREHMKKRKPKTFADL
NHIVNLSLQQTFTRSINTVLTVVIVVVTLLIFGASSITNFSIALLVGLLTGVYSSLYIAA
QIWLAWKGRELKKDSAQ
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaggacgcttgattgcgtttttccttttcgttctattgatcggcacgggcttg
ggctactttacgaagcctgccgctaacaatattacgttaggattggatttgcaaggcgga
tttgaggtgctgtatgatgtacagcctgtaaaaaaaggtgacaaaatcacaaaagacgtt
ctggtcagcacagtagaggcactgaaccgccgggccaatgttctcggtgtcagcgaaccg
aacatccaaattgaagggaataaccggattcgcgttcagctcgctggcgtgacaaaccaa
aacagagcgcgtgaaattttggcgactgaagcgcagctttctttcagagatgcaaatgat
aaggaactgttaaacggtgctgatctagtcgaaaacggcgctaaacaaacttatgatagc
acaacaaatgagccaattgtcacgattaagctgaaagacgctgataaatttggtgaagtg
accaagaaggtcatgaaaatggcgccaaacaaccagcttgtcatttggttggattatgat
aaaggtgattcctttaagaaagaagttcaaaaagagcatcctaaatttgtatccgctcca
aatgtaagtcaggaactaaatacaactgatgtaaaaattgaaggtcatttcacagctcaa
gaagcgaaagatttagccagcattttaaacgcaggcgcacttcctgtgaaactgactgaa
aagtattcgacatcagtaggcgcgcaattcggccagcaggctctccatgatacggtgttt
gccggtattgtcggtatcgcaattattttcttatttatgcttttctattaccgtctgccg
ggattaatcgcggtgattacgctgtctgtttatatctacattacactccagatctttgac
tggatgaatgccgtactcacgcttccgggaattgccgctctcattttaggtgtcgggatg
gctgttgacgccaacattattacctatgagcggattaaagaagagctcaagctaggaaag
tcagtccgctctgccttccgttcaggaaacagacggtcatttgcgacgatttttgacgcg
aatattacaaccattattgcagcggttgtgctctttatctttgggacaagctctgttaaa
gggtttgcgacaatgctgatcctatcgattttgacaagctttatcactgccgttttctta
tcgagatttctcctcgctctccttgtggaaagcagatggcttgatcggaaaaaaggctgg
tttggtgtcaataagaaacatatcatggatattcaggatacggatgaaaatacagagccg
catacgccattccaaaaatgggatttcacgagcaaacgcaaatacttctttattttctcc
agtgcggtcacggttgccgggattattatcctgcttgtgttcaggctgaatcttggcatt
gactttgcaagcggtgcacggattgaagtgcaaagcgaccataagctgacgacagagcaa
gttgagaaggattttgaatctctgggtatggaccctgatactgtagttctgtcaggcgaa
aagagcaatatcggtgttgcccgttttgtcggggtgccagataaagaaaccattgcaaaa
gtaaaaacgtattttaaagacaaatacggatctgatccaaatgtcagcacagtttcaccg
acagtcggtaaggagctggcgagaaatgcgctgtacgcagttgctatagcttctattggc
atcattatttacgtttcaatccgattcgaatacaaaatggcgattgctgccatcgcctca
ttgctatatgacgcattctttatcgtcacgttcttcagtattacaaggcttgaggtagat
gttacattcatcgcggccatcttgacgataatcgggtattccattaacgatacaatcgtt
acatttgacagggtccgcgagcatatgaaaaagcgtaagccgaaaacctttgccgatctg
aaccatattgtaaacctgagcctgcagcaaacctttacacgttcaattaacactgtatta
accgttgtgattgttgttgtgacattgctgatctttggagcatcttctattactaacttc
tcaattgctttattggtcgggctgttaacaggcgtttattcttctctatacattgccgca
caaatttggcttgcatggaaaggaagagaactgaaaaaagattcggcgcaataa

DBGET integrated database retrieval system