KEGG   Bacillus subtilis subsp. subtilis 168: BSU28540
Entry
BSU28540          CDS       T00010                                 

Symbol
ysiB
Name
(RefSeq) enoyl-CoA hydratase
  KO
K13767  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00071  Fatty acid degradation
bsu00362  Benzoate degradation
bsu01100  Metabolic pathways
bsu01120  Microbial metabolism in diverse environments
bsu01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BSU28540 (ysiB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BSU28540 (ysiB)
Enzymes [BR:bsu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BSU28540 (ysiB)
SSDB
Motif
Pfam: ECH_1 ECH_2
Other DBs
NCBI-GeneID: 937448
NCBI-ProteinID: NP_390732
Pasteur: BG12331
BSORF: BG12331
UniProt: P94549 A0A6M4JNW2
LinkDB
Position
complement(2917166..2917942)
AA seq 258 aa
MNAISLAVDQFVAVLTIHNPPANALSSRILEELSSCLDQCETDAGVRSIIIHGEGRFFSA
GADIKEFTSLKGNEDSSLLAERGQQLMERIESFPKPIIAAIHGAALGGGLELAMACHIRI
AAEDAKLGLPELNLGIIPGFAGTQRLPRYVGTAKALELIGSGEPISGKEALDLGLVSIGA
KDEAEVIEKAKALAAKFAEKSPQTLASLLELLYSNKVYSYEGSLKLEAKRFGEAFESEDA
KEGIQAFLEKRKPQFKGE
NT seq 777 nt   +upstreamnt  +downstreamnt
atgaatgcaatttcacttgcggttgatcaatttgtggcagtcttgacgattcacaatccg
ccggcaaacgcgctttcaagccggatattagaagagctgtcttcctgtcttgatcaatgt
gagacagatgcaggcgtacgaagcattatcattcacggcgagggaagatttttctcagcc
ggcgctgatattaaagaatttacatcgcttaaaggcaatgaggattcctcattgctcgct
gagcgcggccagcagttaatggagagaatcgaaagttttccaaaaccgattatcgcagcg
attcacggcgctgctctcggaggcgggctggagcttgcaatggcctgtcacatcagaatc
gcggcagaagatgctaagctggggctcccggagcttaatctcggtatcattccaggtttt
gcggggacacagcgccttccgagatatgtcggtacagccaaagcactggagctcatcgga
tcaggagaaccgatatccggaaaagaagcgcttgatctcggacttgtctcaattggagcg
aaagatgaggcagaagtgattgaaaaagcaaaagcacttgccgctaagtttgcagagaaa
agcccgcaaacgctggcatctttgcttgaacttctttattccaacaaggtgtattcctat
gaaggcagcttaaagcttgaagcaaagcgatttggggaagcatttgagtcagaggacgcc
aaggaaggcatccaggcatttctcgaaaaaagaaagcctcagttcaaaggcgaataa

DBGET integrated database retrieval system