KEGG   Bacillus subtilis subsp. subtilis 168: BSU29100
Entry
BSU29100          CDS       T00010                                 

Gene name
phoR
Definition
(RefSeq) alkaline phosphatase synthesis sensor protein PhoR
  KO
K07636  two-component system, OmpR family, phosphate regulon sensor histidine kinase PhoR [EC:2.7.13.3]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU29100 (phoR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bsu01001]
    BSU29100 (phoR)
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:bsu02022]
    BSU29100 (phoR)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     BSU29100 (phoR)
Protein kinases [BR:bsu01001]
 Histidine kinases
  OmpR family
   BSU29100 (phoR)
Two-component system [BR:bsu02022]
 OmpR family
  PhoR-PhoB (phosphate starvation response)
   BSU29100 (phoR)
SSDB
Motif
Pfam: sCache_like HATPase_c HisKA PAS HATPase_c_3 PAS_4 HATPase_c_2 PAS_10 PAS_9 PAS_7 OmpH HATPase_c_5 PAS_8 Baculo_11_kDa
Other DBs
NCBI-GeneID: 937387
NCBI-ProteinID: NP_390788
Pasteur: BG10364
BSORF: BG10364
UniProt: P23545 A0A6M3ZF44
LinkDB
Structure
PDB: 
3CWF

Position
complement(2976068..2977807)
AA seq 579 aa
MNKYRVRLFSVFVVCMILVFCVLGLFLQQLFETSDQRKAEEHIEKEAKYLASLLDAGNLN
NQANEKIIKDAGGALDVSASVIDTDGKVLYGSNGRSADSQKVQALVSGHEGILSTTDNKL
YYGLSLRSEGEKTGYVLLSASEKSDGLKGELWGMLTASLCTAFIVIVYFYSSMTSRYKRS
IESATNVATELSKGNYDARTYGGYIRRSDKLGHAMNSLAIDLMEMTRTQEMQRDRLLTVI
ENIGSGLIMIDGRGFINLVNRSYAKQFHINPNHMLRRLYHDAFEHEEVIQLVEDIFMTET
KKCKLLRLPIKIERRYFEVDGVPIMGPDDEWKGIVLVFHDMTETKKLEQMRKDFVANVSH
ELKTPITSIKGFTETLLDGAMEDKEALSEFLSIILKESERLQSLVQDLLDLSKIEQQNFT
LSIETFEPAKMLGEIETLLKHKADEKGISLHLNVPKDPQYVSGDPYRLKQVFLNLVNNAL
TYTPEGGSVAINVKPREKDIQIEVADSGIGIQKEEIPRIFERFYRVDKDRSRNSGGTGLG
LAIVKHLIEAHEGKIDVTSELGRGTVFTVTLKRAAEKSA
NT seq 1740 nt   +upstreamnt  +downstreamnt
atgaataaataccgtgtgcgccttttttctgtattcgttgtctgtatgattctggtgttt
tgtgtcctcgggctgtttttacagcagctttttgaaacatctgatcaaaggaaagcagag
gaacacattgaaaaagaagcaaaatacttggcttcgcttcttgatgccggcaatctgaat
aatcaagcaaatgagaaaatcattaaagatgcaggcggcgcgcttgatgtgagcgcatcc
gttatcgatacagacggtaaggtgctgtatgggtcaaacggtagatcggctgattcccaa
aaggtgcaggcgcttgtttctggccatgagggtattctgtcaacaacagataacaagctt
tattacggactttcacttagaagcgaaggtgaaaaaacaggatatgtgctgctttccgcc
tctgaaaaaagcgacggcttaaaaggcgaattgtgggggatgctgacggccagtctttgt
accgcatttatcgtcattgtttatttttattccagcatgacctcacgttataaaaggtca
attgagtcagcgacaaatgtagccacagaactctctaagggcaactacgatgcacggacg
tacggcggctatattaggcgttctgataagctaggacatgcgatgaacagccttgccatt
gatctgatggaaatgacgcgaacgcaggaaatgcagcgggatcggctgctgacagtcatt
gaaaacattggctccgggctgattatgatcgacggaagaggctttattaatctcgtaaac
aggtcttacgccaagcagtttcatatcaatccgaatcatatgctgcgccgtctttatcac
gatgcatttgaacatgaagaagtgatccagcttgtcgaagacatttttatgacggagaca
aagaaatgcaagctgttaagactgccgatcaaaatagaacggcgttattttgaagtggac
ggcgttccgattatggggccggacgatgaatggaaaggaattgtgctcgttttccatgac
atgacggaaacgaagaaattagagcagatgaggaaggattttgtggccaatgtttctcat
gagctgaaaacaccgattacgtccataaaagggtttacggagacgttattggacggggcg
atggaagacaaagaggcgctttctgaatttctctctattattcttaaggaaagcgaaagg
cttcagtctttggttcaggatttgctcgatctctcaaaaatcgagcagcaaaatttcacg
ctcagtatcgaaacgtttgagccggccaaaatgcttggtgagattgaaacgcttctgaag
cataaggcggatgagaaaggcatctccttgcacctgaatgtcccgaaagaccctcaatat
gtatctggtgacccgtacaggctgaaacaggtatttcttaatctcgtaaacaatgcatta
acctacacgcctgaggggggctccgtggctatcaatgtaaagcccagagaaaaagacatt
cagattgaggttgccgattctggaatcggaattcagaaagaagaaattccgcgcatcttt
gaacgcttttaccgtgtagataaagacagaagcagaaattcgggcggaaccgggctgggc
ctagcgattgtcaagcatttaatagaggctcatgaagggaaaattgatgtcacaagcgag
cttggacggggaactgtctttaccgtgacgctgaaacgggccgctgaaaagtccgcctaa

DBGET integrated database retrieval system