KEGG   Bacillus subtilis subsp. subtilis 168: BSU29110
Entry
BSU29110          CDS       T00010                                 
Symbol
phoP
Name
(RefSeq) alkaline phosphatase synthesis transcriptional regulatory protein PhoP
  KO
K07658  two-component system, OmpR family, alkaline phosphatase synthesis response regulator PhoP
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU29110 (phoP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:bsu02022]
    BSU29110 (phoP)
Two-component system [BR:bsu02022]
 OmpR family
  PhoR-PhoB (phosphate starvation response)
   BSU29110 (phoP)
SSDB
Motif
Pfam: Response_reg Trans_reg_C FleQ TrkA_N
Other DBs
NCBI-GeneID: 936644
NCBI-ProteinID: NP_390789
Pasteur: BG10363
UniProt: P13792 A0A6M3ZF31
Structure
LinkDB
Position
complement(2977800..2978522)
AA seq 240 aa
MNKKILVVDDEESIVTLLQYNLERSGYDVITASDGEEALKKAETEKPDLIVLDVMLPKLD
GIEVCKQLRQQKLMFPILMLTAKDEEFDKVLGLELGADDYMTKPFSPREVNARVKAILRR
SEIAAPSSEMKNDEMEGQIVIGDLKILPDHYEAYFKESQLELTPKEFELLLYLGRHKGRV
LTRDLLLSAVWNYDFAGDTRIVDVHISHLRDKIENNTKKPIYIKTIRGLGYKLEEPKMNE
NT seq 723 nt   +upstreamnt  +downstreamnt
atgaacaagaaaattttagttgtggatgatgaagaatctattgttactcttttacagtac
aatttggaacggtcaggctatgatgtcattaccgcctcggatggggaagaagcactcaaa
aaagcggaaacagagaaacctgatttgattgtgcttgatgtgatgcttccaaaattggac
ggaatcgaagtatgcaagcagctgagacagcaaaaactgatgtttcccattttaatgctg
acagcgaaggatgaggaattcgacaaagtattagggctggagctcggtgctgatgattat
atgaccaagccgttcagtccaagggaagtaaatgcgagagtcaaagcgattttaaggcgt
tcggaaatagctgcgccctctagtgagatgaagaacgatgaaatggaaggccagatcgta
atcggcgatctgaaaatcctgcctgatcattatgaagcgtactttaaagaaagtcagctt
gaactgacaccgaaagaattcgaactgctgctctatttaggcagacataaaggcagagtt
ctgacaagagacctgctgctgagcgcagtctggaattatgattttgccggagatacgaga
attgttgatgtgcacatcagccatcttcgcgacaaaattgaaaacaataccaaaaaaccg
atctacattaaaacgattaggggattggggtataaactggaggagccaaaaatgaatgaa
taa

DBGET integrated database retrieval system