KEGG   Bacillus subtilis subsp. subtilis 168: BSU29210
Entry
BSU29210          CDS       T00010                                 
Symbol
accD
Name
(RefSeq) acetyl-CoA carboxylase carboxyltransferase subunit beta
  KO
K01963  acetyl-CoA carboxylase carboxyl transferase subunit beta [EC:6.4.1.2 2.1.3.15]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00061  Fatty acid biosynthesis
bsu00620  Pyruvate metabolism
bsu00640  Propanoate metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01120  Microbial metabolism in diverse environments
bsu01200  Carbon metabolism
bsu01212  Fatty acid metabolism
Module
bsu_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BSU29210 (accD)
   00640 Propanoate metabolism
    BSU29210 (accD)
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BSU29210 (accD)
Enzymes [BR:bsu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     BSU29210 (accD)
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     BSU29210 (accD)
SSDB
Motif
Pfam: Carboxyl_trans zf-ACC RNA_POL_M_15KD DUF2387
Other DBs
NCBI-GeneID: 936186
NCBI-ProteinID: NP_390799
Pasteur: BG13926
UniProt: C0SP93 A0A6M3ZF41
LinkDB
Position
complement(2988693..2989565)
AA seq 290 aa
MLKDIFTKKKKYASVPSDQAKHDVPEGIMTKCPKCKKIMLTKELDKNMRVCMNCDYHFPM
NAKQRIESLMDEQSFEEFNQGMLSENPLGFPGYLEKLEKDREKTSLNEAVVTGKGTIGGH
PAVVAVMDSSFRMGSMGSVVGEKITLAIEKAKADKVPFIIFTASGGARMQEGVLSLMQMA
KTSSALKLFSEEQGLIISVMTHPTTGGVSASFASLGDYNFAEPGALIGFAGRRIIEQTIG
EKLPEDFQTAEFLLKHGQLDAVIHRDDMKKTLENLLDMHQTGGDIEWLQD
NT seq 873 nt   +upstreamnt  +downstreamnt
ttgttaaaggatatattcacgaaaaagaaaaagtatgcttccgtaccgtctgatcaagcg
aagcacgatgttccggaaggcattatgacaaaatgtcctaagtgtaaaaaaatcatgctc
actaaagagttggataaaaatatgcgggtatgcatgaactgcgattatcatttcccaatg
aacgcaaaacagcgtatcgaaagcttgatggatgaacaatcctttgaggaatttaatcag
ggaatgctctcggaaaatccgcttggtttcccgggatatctggaaaagcttgaaaaagat
cgcgagaaaacatccttaaacgaggctgttgtgacaggcaagggcaccatcggcggacac
ccggctgttgtcgccgtcatggactcttcattcagaatgggcagcatgggttcagtcgtc
ggtgaaaaaatcacgcttgcgattgaaaaagcaaaagctgataaagttccgtttattatt
tttacggcttcaggcggtgctagaatgcaggaaggcgtattaagtttgatgcagatggca
aagacaagctctgcgttaaaactgttcagtgaagaacagggtcttattatttcagtaatg
acgcatccgactaccgggggcgtatcagcaagctttgcatcccttggcgattacaatttc
gctgagcctggcgcgctgatcggttttgccggaagacggattattgaacagacaatagga
gaaaaactgcctgaggacttccaaacggctgagtttttattaaaacatggacagcttgat
gcggttattcatcgcgacgatatgaaaaaaacgttagaaaatctgctggatatgcatcaa
acaggaggtgacattgagtggctccaagattag

DBGET integrated database retrieval system