KEGG   Bacillus subtilis subsp. subtilis 168: BSU29390
Entry
BSU29390          CDS       T00010                                 

Symbol
ytmI
Name
(RefSeq) N-acetyltransferase YtmI
  KO
K00680  uncharacterized N-acetyltransferase [EC:2.3.1.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU29390 (ytmI)
Enzymes [BR:bsu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.-  
     BSU29390 (ytmI)
SSDB
Motif
Pfam: Acetyltransf_1 Acetyltransf_7 Acetyltransf_9 Acetyltransf_10
Other DBs
NCBI-GeneID: 937353
NCBI-ProteinID: NP_390817
Pasteur: BG13883
BSORF: BG13883
UniProt: O34350 A0A6M3ZF70
LinkDB
Position
complement(3008249..3008785)
AA seq 178 aa
MSDDIFRLATVEDASELLKLVNSAFQPIRQLDIDWPSTRADIQMVSENIEHHSAIVLERD
GKLISTITIRFPWESETPPSKYPFVWWFATLPEYKGQGAGSKLLTYVEEKVLRDMLKAPA
LTLGTSARKHPWLADMYRRRGYEVYFEQEKDGDIGVMMHKVLIPERFNPTLLGAPSWA
NT seq 537 nt   +upstreamnt  +downstreamnt
atgagtgatgatatttttcgactggcaactgttgaagatgcatcggagctgttgaaactg
gttaacagcgcatttcagcccattcggcagctggatattgattggccatccacgagagct
gatatccaaatggtatcagaaaatattgaacatcattcagcgattgtgctggagcgggat
gggaagctgatttcaacgattacaatcaggttcccgtgggagagtgagacgcctccttca
aaatatccatttgtgtggtggtttgcgacactgccggaatataaagggcaaggcgccgga
agtaagctgcttacgtatgttgaagaaaaagtgcttcgagatatgctgaaggctcctgcg
ctgacactcggcacatcggcgcgcaagcatccttggcttgctgacatgtacagaaggaga
gggtatgaagtgtattttgagcaggaaaaagacggggacataggtgtgatgatgcacaag
gttctgattccggaacgatttaacccaacgcttttaggtgcgcccagctgggcatga

DBGET integrated database retrieval system