KEGG   Bacillus subtilis subsp. subtilis 168: BSU29410
Entry
BSU29410          CDS       T00010                                 

Symbol
ytkL
Name
(RefSeq) metal-dependent hydrolase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Lactamase_B_3 Lactamase_B_2 Lactamase_B
Other DBs
NCBI-GeneID: 936598
NCBI-ProteinID: NP_390819
Pasteur: BG13871
BSORF: BG13871
UniProt: Q795U4 A0A6M3ZFF9
LinkDB
Position
complement(3009915..3010598)
AA seq 227 aa
MKVTYHGHSVITVETKDHHIIFDPFLTGNSLTDIKPEDVKADVILLTHGHNDHVGDTEQI
AKQNNALVIAPNELAVYLGWKGLNVHPMHIGGSRQFDFGKVKLTQAFHGSAITDEENKTI
TYTGMPAGILLTVEDKTIFHAGDTALFSDMKLIGELNHIDLAFLPIGDNFTMGPEDAKLA
AEWLRAKQVVPVHYNTFPVIEQDPEAFADSLPGGVGKVMSVGETIEL
NT seq 684 nt   +upstreamnt  +downstreamnt
atgaaagtgacatatcacggacattctgtaatcacagtggaaacgaaggaccatcatatt
atttttgatccgtttttaacagggaattcattaacggatataaagccggaggatgtaaaa
gcggatgtcatcttactaacgcacggccacaatgaccatgtcggtgatactgaacaaatc
gccaagcaaaataacgcgctggttatagccccgaacgagctcgctgtgtacttaggctgg
aaaggcttgaatgttcatccaatgcatattggcggctcccgccagttcgattttggaaaa
gtgaagctcacacaggcctttcatggatcagccatcacagatgaagaaaacaaaacgatc
acttacacaggcatgcctgccggtattttgctgactgtagaagataaaacgattttccac
gcgggcgatacggcacttttctctgatatgaaactcattggcgaattgaatcatatcgac
cttgctttccttccgattggcgataactttacaatggggcctgaagacgccaagcttgct
gctgaatggctgcgcgcaaaacaggtcgtgccggtgcattacaatacattcccggtcatc
gaacaagacccagaagcattcgctgacagcctgccgggcggagtcggcaaagtcatgtcg
gtcggtgagacgatcgagctttaa

DBGET integrated database retrieval system