KEGG   Bacillus subtilis subsp. subtilis 168: BSU29420Help
Entry
BSU29420          CDS       T00010                                 

Gene name
fabG
Definition
(RefSeq) oxidoreductase
  KO
K00059  3-oxoacyl-[acyl-carrier protein] reductase [EC:1.1.1.100]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00061  Fatty acid biosynthesis
bsu00780  Biotin metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01212  Fatty acid metabolism
Module
bsu_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BSU29420 (fabG)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BSU29420 (fabG)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    BSU29420 (fabG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bsu01004]
    BSU29420 (fabG)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.100  3-oxoacyl-[acyl-carrier-protein] reductase
     BSU29420 (fabG)
Lipid biosynthesis proteins [BR:bsu01004]
 Fatty acid synthase
  Component type
   BSU29420 (fabG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR NAD_binding_10 Epimerase GDP_Man_Dehyd
Motif
Other DBs
NCBI-GeneID: 937351
NCBI-ProteinID: NP_390820
Pasteur: BG13870
BSORF: BG13870
UniProt: O34308
LinkDB All DBs
Position
complement(3010661..3011428)
Genome map
AA seq 255 aa AA seqDB search
MRHALITAGSKGLGRKVTETLLAKGYSVTVNYRQDEEAVSRLKEACPDCLDRLQFVKGDV
TKKEDLLRIAEAALNRFGRIDFLINNAGPYIFERKKLADYTDDEWYGMLEGNLSAVFHLF
KAVIPIMRKQQFGRIITYGFQGAAHAPGWLHRSAFGAAKVGLASLTKTIAIEEAEFGITA
NMVCPGDIVGDMKEASIEEARMRIGKEKTPIGRSGTGEDIARIIAFLCEENSDLVTGTVI
EATGGLNVINKNQTT
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
gtgcgacatgctttaattactgccggttcgaagggtttaggccgcaaagtgactgaaacg
ttgcttgcaaaggggtattcagtaacagtcaattacagacaggatgaggaggcagtcagc
cgcctgaaggaagcctgtcccgattgtcttgaccggctgcaatttgtaaaaggtgatgtc
accaaaaaagaagatctgctgcgtattgcagaggctgccttaaaccgcttcggaaggatc
gactttttgattaacaacgctggaccatacatatttgaacgtaaaaagttagccgattat
actgatgatgaatggtatggcatgctggaaggaaatttaagcgccgtctttcatttattc
aaagcggttattcctattatgagaaaacagcaatttggacgcattattacgtacggattc
caaggtgcggctcacgcgcccggctggcttcaccgatcggcatttggcgctgcgaaagtg
ggcttggcttctttgacgaagacaattgccattgaagaagccgaattcggcataaccgcc
aacatggtttgcccaggagacattgtcggcgacatgaaagaagcatcgatagaggaagcc
agaatgcgaatcggcaaagaaaaaacgccgataggaagatccggtacaggcgaggatatt
gccaggattatcgctttcttgtgtgaggagaactcagaccttgtgacagggactgtcatt
gaagccaccggaggcctcaatgtcattaacaagaatcaaacaacataa

DBGET integrated database retrieval system