KEGG   Bacillus subtilis subsp. subtilis 168: BSU29520
Entry
BSU29520          CDS       T00010                                 
Symbol
yteJ
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: RDD Pex2_Pex12
Other DBs
NCBI-GeneID: 937343
NCBI-ProteinID: NP_390830
Pasteur: BG13840
BSORF: BG13840
UniProt: O34424 A0A6M4JMF8
LinkDB
Position
complement(3019533..3020027)
AA seq 164 aa
MDATYEELERNDIKGPQEAELLTHAYAGFWVRFWAFLLDWLVIWGLNHLLVSPLFTVLDL
PKTSGMFTFSAYSVTTLIVYLAYFALMTKYFRQTLGKMVFGLKVVSVKQDSKLTWSTVIF
REVVGRYIDKIWILYIVVAFSPTKQGIHDYIADTTVVHEKLYRK
NT seq 495 nt   +upstreamnt  +downstreamnt
atggacgcgacatatgaagagttagagcgcaatgacatcaaaggcccgcaagaagcggag
ctgctgacacatgcctatgctggcttttgggttcgtttctgggctttcctgcttgattgg
ctcgtgatatggggattaaaccatttgctcgtttctcccctctttaccgtattggatctg
ccgaaaacatccggcatgtttaccttctcggcctacagtgtgacaacgcttattgtgtat
cttgcctatttcgcactcatgacaaaatacttcaggcagacgcttggtaaaatggtgttc
ggcctcaaagtggtttctgtgaagcaagatagcaagctgacatggagtacagtgattttt
cgtgaagtggttggacggtatattgataagatttggattttatatatcgttgttgccttt
tcacctacaaaacaagggattcatgattacatcgcggataccaccgtggtgcatgaaaaa
ttataccgcaaataa

DBGET integrated database retrieval system