KEGG   Bacillus subtilis subsp. subtilis 168: BSU29960
Entry
BSU29960          CDS       T00010                                 
Symbol
ytlP
Name
(RefSeq) hypothetical protein
  KO
K01975  RNA 2',3'-cyclic 3'-phosphodiesterase [EC:3.1.4.58]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bsu03016]
    BSU29960 (ytlP)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.58  RNA 2',3'-cyclic 3'-phosphodiesterase
     BSU29960 (ytlP)
Transfer RNA biogenesis [BR:bsu03016]
 Prokaryotic type
  tRNA spricing factors
   Other tRNA splicing factors
    BSU29960 (ytlP)
SSDB
Motif
Pfam: LigT_PEase 2_5_RNA_ligase2 AKAP7_NLS
Other DBs
NCBI-GeneID: 937293
NCBI-ProteinID: NP_390874
Pasteur: BG13878
BSORF: BG13878
UniProt: O34570 A0A6M4JNR3
LinkDB
Position
complement(3065751..3066302)
AA seq 183 aa
MPDIRPHYFIGVPIPEGIANPIYQAAKNEPILTFQKWVHPLDYHITLIFLGAADETQIKK
LEGSLAEIASEIDPFSIKFGKIDVFGDRRKPRVLHLEPKKNKTLDRLREHTKQAVLQAGF
QVEKRPYHPHMTLARKWTGEDGFPAHVPFESGEVSMMAERFSLFQIHLNQSPKYEEIFKF
QLS
NT seq 552 nt   +upstreamnt  +downstreamnt
atgccagatatacggcctcattatttcatcggcgttcccatacctgagggaattgcaaat
ccgatctaccaggctgcgaaaaacgaaccgatattgacgtttcaaaaatgggtgcacccg
cttgactatcatatcacgttaatttttctcggagcggcggatgagacacaaataaagaag
cttgaaggttcgctagcagagattgcttcagaaattgatccattttcaattaagtttggc
aagatagatgtattcggcgaccgcagaaagccgcgcgttttacatctggagccaaagaaa
aacaaaacgcttgatagactgcgggaacatacgaagcaggctgtacttcaggccggcttt
caagtggaaaaaagaccgtatcatcctcatatgacgctggcaagaaaatggacaggcgaa
gatggatttccagctcatgttccgtttgaaagcggcgaggtttcgatgatggctgaacga
ttttcgctctttcaaatacacttgaaccaatcaccaaaatacgaggaaatattcaaattt
caattatcttaa

DBGET integrated database retrieval system