KEGG   Bacillus subtilis subsp. subtilis 168: BSU30350Help
Entry
BSU30350          CDS       T00010                                 

Gene name
yttB
Definition
(RefSeq) MFS transporter
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 MFS_1_like MFS_2
Motif
Other DBs
NCBI-GeneID: 936526
NCBI-ProteinID: NP_390913
Pasteur: BG13925
BSORF: BG13925
UniProt: O34546
LinkDB All DBs
Position
complement(3107232..3108425)
Genome map
AA seq 397 aa AA seqDB search
MPRALKILVIGMFINVTGASFLWPLNTIYIHNHLGKSLTVAGLVLMLNSGASVAGNLCGG
FLFDKIGGFKSIMLGIAITLASLMGLVFFHDWPAYIVLLTIVGFGSGVVFPASYAMAGSV
WPEGGRKAFNAIYVAQNAGVAVGSALGGVVASFSFSYVFLANAVLYLIFFFIVYFGFRNI
QTGDASQTSVLDYDAVNSKAKFAALIILSGGYVLGWLAYSQWSTTIASYTQSIGISLSLY
SVLWTVNGILIVLGQPLVSFVVKKWAESLKAQMVIGFIIFIVSFSMLLTAKQFPMFLAAM
VILTIGEMLVWPAVPTIANQLAPKGKEGFYQGFVNSAATGGRMIGPLFGGVLVDHYGIRA
LVLSLLVLLLISIATTLLYDKRIKSAKETNKQASISS
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgtgctcttaaaattttagtcattggaatgtttatcaatgtgacgggtgcttct
tttttatggccgctgaatacgatttatatccataatcatttaggaaagtcgttaacagta
gccggacttgtcctgatgctgaattccggcgccagtgtggctggcaatttatgcggaggt
tttttgtttgataaaatcggcggttttaaatcgattatgcttgggatagccattacgtta
gcaagcctgatgggtcttgtcttttttcatgattggccagcctatattgtgctgctgacg
attgtgggctttggctccggtgttgtttttccggcaagctacgcaatggcgggatcggta
tggcctgaagggggaaggaaggcatttaatgcgatatatgtcgcgcaaaacgcgggcgtg
gccgttggttcagcgcttggcggtgtcgtggcatctttctcgttttcatatgtatttttg
gcaaatgccgtattgtatctgatctttttctttattgtatatttcggatttcgaaatatt
caaacgggcgatgcatcccaaacatccgtgcttgattatgatgctgtgaacagcaaagca
aaatttgccgcactgatcattttaagcggaggctatgtactcggatggctggcttattct
cagtggtcaaccacaattgcttcgtacacacaaagcattggaatatctctttccttatac
agcgtgctgtggacggttaacggaattctcattgtgctcggccagccgctcgtcagtttt
gtggtgaaaaaatgggccgagtcgctaaaagcgcaaatggtcatcggctttatcattttt
attgtgtctttcagcatgctgctgactgcaaagcaatttccgatgtttctcgctgcgatg
gtgatcctgactatcggagaaatgcttgtttggcctgctgtgccgactattgccaatcag
cttgcccctaaagggaaagaaggcttttatcaaggctttgtcaacagtgcggcgacaggc
ggcagaatgattggtcccctgttcggaggagtgcttgtcgatcattacggcattagggct
cttgttttatctctgttggtattgctgctgatcagtattgccacaacgcttctatatgac
aaacggataaaatcagctaaagaaacaaataagcaggcatcaatctcttcataa

DBGET integrated database retrieval system