KEGG   Bacillus subtilis subsp. subtilis 168: BSU30650
Entry
BSU30650          CDS       T00010                                 

Gene name
dps
Definition
(RefSeq) general stress protein 20U
  KO
K04047  starvation-inducible DNA-binding protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bsu03036]
    BSU30650 (dps)
Chromosome and associated proteins [BR:bsu03036]
 Prokaryotic type
  Nucleoid associated proteins
   Other nucreoid associated proteins
    BSU30650 (dps)
SSDB
Motif
Pfam: Ferritin DUF5856 DUF3855 KNTase_C DUF5063
Other DBs
NCBI-GeneID: 937211
NCBI-ProteinID: NP_390943
Pasteur: BG12584
BSORF: BG12584
UniProt: P80879 A0A6M3ZFB9
LinkDB
Position
complement(3136238..3136675)
AA seq 145 aa
MSEQLIQAVNKQVANWTVMYVKLHNYHWYVKGKDFFTLHEKFEELYNETATYIDDLAERL
LALNGKPIATMKESLETASVKEAAGNETAEQMVQSVYDDFTVIAEELKNGMDLADEVGDE
TTGDMLLAIHQNIEKHNWMLKAYLG
NT seq 438 nt   +upstreamnt  +downstreamnt
atgtcagaacaattgattcaagcagtgaacaaacaagtagccaactggacggtcatgtat
gtgaaactacataattatcactggtatgtgaaagggaaagatttcttcactcttcatgaa
aagtttgaggagctgtacaacgaaacagcaacttatattgatgacttagcagaacgtctt
ttggcgctgaacggaaaaccgattgcaacaatgaaggaatccttagaaacggcttctgtc
aaagaagctgctggaaatgaaacagctgaacaaatggttcaaagcgtatatgatgatttc
acagtcatcgcggaagagctgaaaaacggcatggatttagctgatgaagtcggtgacgaa
acaacaggggacatgcttcttgcgatccatcaaaatattgaaaaacataactggatgcta
aaagcttacctaggttaa

DBGET integrated database retrieval system