KEGG   Bacillus subtilis subsp. subtilis 168: BSU30760
Entry
BSU30760          CDS       T00010                                 
Symbol
mntB
Name
(RefSeq) manganese transport system ATP-binding protein MntB
  KO
K11710  manganese/zinc/iron transport system ATP- binding protein [EC:7.2.2.5]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU30760 (mntB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU30760 (mntB)
Enzymes [BR:bsu01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.5  ABC-type Mn2+ transporter
     BSU30760 (mntB)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Manganese/zinc/iron transporter
    BSU30760 (mntB)
SSDB
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_23 SbcC_Walker_B AAA_29 ATPase_2 RsgA_GTPase AAA_16 MMR_HSR1 AAA_18 AAA_27 MeaB DO-GTPase2 AAA_22 Resolvase SpoIVA_ATPase NTPase_1 AAA_15 AAA_24 Mg_chelatase RNA_helicase AAA_33 NB-ARC
Other DBs
NCBI-GeneID: 937196
NCBI-ProteinID: NP_390954
Pasteur: BG13852
BSORF: BG13852
UniProt: O34338 A0A6M4JM89
LinkDB
Position
complement(3144267..3145019)
AA seq 250 aa
MFPVELDNVTVAYHKKPVLQDISLQVPEGKLIGIIGPNGAGKSTLIKTILGLVPRASGDI
SIYGKDYKDQRTRIGYVPQRGSVDWDFPTSPLDVVLMGRYGRIGLLKRPKKADVEMAKAA
LTKVGMHDYAKRQISQLSGGQQQRVFLARALCQNADIYFMDEPFAGVDAATERAIMTLLA
ELKEKGKTVLVVHHDLQTAEDYFDWILLLHLRKIAFGPTENVFTIENLQKTYGGRLTFLK
DKVLAEGHKE
NT seq 753 nt   +upstreamnt  +downstreamnt
atgttccctgttgagcttgataatgtgacggttgcttatcataaaaagcctgtactgcag
gacatttcgctgcaggtgcctgaaggaaaacttattggcattatcggcccaaacggcgcg
ggaaaatcaaccttgatcaaaacgattctcggtcttgtgcccagagcttccggagacatc
tctatttacggcaaagactataaggatcagcggaccagaatcggatatgttccgcagcgc
ggctcggttgactgggatttccccacaagcccgctcgatgtcgtcctaatgggaagatac
gggagaatcggtttattaaagaggccaaagaaagcggatgtggagatggcgaaggccgca
ttaacaaaagtcgggatgcatgattatgcgaaaaggcaaatcagccagctgtcaggcgga
cagcagcagcgggtgtttcttgcccgggcactctgccagaacgctgacatttattttatg
gatgaaccgtttgcaggtgttgatgcagcgacggagcgcgcgattatgacgctgttggca
gaactcaaagaaaaaggaaaaaccgtgcttgtcgtccatcatgatctgcagaccgccgag
gattatttcgattggatcttactgcttcatttaaggaaaatcgctttcggaccgacggaa
aacgtttttacgatcgaaaacctgcaaaaaacatatggaggaaggcttacgtttttaaaa
gataaagtgctggcagaaggacataaggagtga

DBGET integrated database retrieval system