KEGG   Bacillus subtilis subsp. subtilis 168: BSU30800
Entry
BSU30800          CDS       T00010                                 

Symbol
menB
Name
(RefSeq) 1,4-dihydroxy-2-naphthoyl-CoA synthase
  KO
K01661  naphthoate synthase [EC:4.1.3.36]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00130  Ubiquinone and other terpenoid-quinone biosynthesis
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    BSU30800 (menB)
Enzymes [BR:bsu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.36  1,4-dihydroxy-2-naphthoyl-CoA synthase
     BSU30800 (menB)
SSDB
Motif
Pfam: ECH_1 ECH_2 DUF1666 SDH_sah
Other DBs
NCBI-GeneID: 937195
NCBI-ProteinID: NP_390958
Pasteur: BG10686
BSORF: BG10686
UniProt: P23966 A0A6M3ZIS3
LinkDB
Position
complement(3148901..3149716)
AA seq 271 aa
MAEWKTKRTYDEILYETYNGIAKITINRPEVHNAFTPKTVAEMIDAFADARDDQNVGVIV
LAGAGDKAFCSGGDQKVRGHGGYVGDDQIPRLNVLDLQRLIRVIPKPVVAMVSGYAIGGG
HVLHIVCDLTIAADNAIFGQTGPKVGSFDAGYGSGYLARIVGHKKAREIWYLCRQYNAQE
ALDMGLVNTVVPLEQLEEETIKWCEEMLEKSPTALRFLKAAFNADTDGLAGIQQFAGDAT
LLYYTTDEAKEGRDSFKEKRKPDFGQFPRFP
NT seq 816 nt   +upstreamnt  +downstreamnt
atggctgaatggaaaacaaaacggacatacgatgagatattgtatgaaacgtataatggc
attgcaaaaataacaatcaaccgacctgaggtacataatgcgtttacccctaaaacggtt
gctgaaatgattgatgcgtttgctgacgcaagagacgaccaaaacgttggggttatcgtg
cttgccggtgcaggggacaaagcattttgttctggcggagaccaaaaagtgcgcggccac
ggtggatatgtaggagacgaccagatccctcgtcttaacgtattggatcttcagcgttta
atccgcgtcatcccgaaaccggttgttgcgatggtgtccggatatgcgatcggcggaggc
catgtgcttcacatcgtatgtgacttgacaattgctgcggacaacgcaatttttggacaa
acaggccctaaagtgggaagcttcgatgcaggttacggttctggctacctggctcgaatt
gtaggacataaaaaagcacgtgaaatctggtacctatgccgtcagtacaacgcacaggaa
gcactggacatgggtcttgtcaacacagtcgttcctttggaacagcttgaagaagaaacg
attaaatggtgtgaagaaatgcttgaaaaaagcccgaccgcactgcgctttcttaaagct
gcgtttaacgcggacacagacggacttgctggaattcagcagtttgcaggggatgctacc
cttctttactacacaacagatgaagcaaaagaaggccgtgattcctttaaggaaaaacgc
aaacctgatttcggacagttccctcgttttccgtga

DBGET integrated database retrieval system