KEGG   Bacillus subtilis subsp. subtilis 168: BSU30870Help
Entry
BSU30870          CDS       T00010                                 

Gene name
ytcB
Definition
(RefSeq) UDP-glucose epimerase YtcB
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD NAD_binding_4 RmlD_sub_bind Polysacc_synt_2 NAD_binding_10 NmrA FAD_binding_4 DapB_N Ldh_1_N
Motif
Other DBs
NCBI-GeneID: 938900
NCBI-ProteinID: NP_390965
Pasteur: BG13829
BSORF: BG13829
UniProt: O34886
LinkDB All DBs
Position
3157008..3157958
Genome map
AA seq 316 aa AA seqDB search
MKILVTGAAGFIGSHLCEELLKDKKHNVIGIDDFIGPTPFSLKLKNLKNLLPEKRFTFIK
ENLLTADLASLLEGVDVIFHLAAIPGVRSSWGNHFHPYAAHNIQALQRLLEACREHSIQT
FVFASTSSVYGEKQGKVSENTSLSPLSPYGVTKLTGEKLCHVYKQSFGIPIVILRFFTVY
GPRQRPDMAFHRLIKQHLQQKPLTIFGDGQQSRDFTYISDCVKGITAVLGKPHLIGETVN
IGGAERASVLKVVSLIEDISGRKATLHFSDKIAGEPSNTWADISKAKQLLHYDPATSLKD
GLTNEIAYLSSLYQGE
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatactcgtcacaggagcagcgggctttatcggctcccacctctgcgaagaatta
ctaaaagataagaaacataacgttatcggaatcgatgactttatcggtcctactccattt
tccttgaaattaaaaaaccttaaaaacctgctgccggaaaagcgatttacgttcataaag
gaaaatctgctgacagccgatcttgcttccttactggaaggagtggacgtcatctttcat
ttggcggccataccgggtgtccgctcaagctggggcaatcattttcacccatatgccgca
cataatatccaagcgctccaaaggctcctcgaggcgtgccgggaacattctattcaaacg
ttcgtctttgcatccacctcttccgtctatggcgaaaaacaaggaaaagtcagcgaaaac
acgtcgctttctcctttatctccgtacggggtaacaaagcttacgggagaaaagctttgc
catgtgtataaacagagctttggcattccaattgtgattctccgtttttttaccgtatac
gggccaagacagcggccggatatggcttttcaccggctcattaagcagcaccttcagcaa
aagccgcttaccatcttcggtgatgggcagcagtcaagagatttcacttatatcagcgac
tgtgtcaaaggcatcaccgctgttcttgggaaaccccaccttattggtgaaacagtaaat
atcggcggcgcagagcgtgcctcagtcttaaaagttgtctccctcattgaggatatttcc
gggagaaaagcaacactgcacttttcggacaaaatagcaggggaaccgagcaacacgtgg
gcggatatttcaaaagcaaaacagctcttgcattatgatcccgccacatccttaaaggat
ggcttgaccaacgaaatcgcctatttatcgtcgctgtatcagggggaataa

DBGET integrated database retrieval system