KEGG   Bacillus subtilis subsp. subtilis 168: BSU32170
Entry
BSU32170          CDS       T00010                                 

Symbol
dapF
Name
(RefSeq) diaminopimelate epimerase
  KO
K01778  diaminopimelate epimerase [EC:5.1.1.7]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00300  Lysine biosynthesis
bsu00470  D-Amino acid metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01120  Microbial metabolism in diverse environments
bsu01230  Biosynthesis of amino acids
Module
bsu_M00525  Lysine biosynthesis, acetyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    BSU32170 (dapF)
  09106 Metabolism of other amino acids
   00470 D-Amino acid metabolism
    BSU32170 (dapF)
Enzymes [BR:bsu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.7  diaminopimelate epimerase
     BSU32170 (dapF)
SSDB
Motif
Pfam: DAP_epimerase PhzC-PhzF Pro_racemase
Other DBs
NCBI-GeneID: 937110
NCBI-ProteinID: NP_391097
Pasteur: BG14048
BSORF: BG14048
UniProt: O32114 A0A6M3ZG94
LinkDB
Position
complement(3306040..3306894)
AA seq 284 aa
MNSFRFTKMHGLGNSYIYVNQFEEQLPEEKLSEIAIQVSSVYTGIGSDGMILICPSDQAP
VKMRIFNNDGSEGKNCGNGLRCVAKYAYEHKLVEETSFLIETLSGLVKAEVQVENGKVNV
VTVDMGEPRLTKSELPMLDGGEEHTINETMAFGEVELTGTAVSMGNPHIVFPIADIEQAP
LTTLGPVIEKDPRFPEGINVEFVETVNEQELHFRVWERGSGITQACGTGACAAAVASVLN
GVSKRNQDITVHLAGGDLVINWKDNGHVMMTGPAETVCEGVYFL
NT seq 855 nt   +upstreamnt  +downstreamnt
atgaactcatttcgatttaccaaaatgcacggcctgggaaacagttatatttatgtgaat
caatttgaagaacagcttccagaagaaaaactgtcagagattgcaattcaggtttcttct
gtttatacagggatcggatccgacggaatgatcctgatatgcccatcagaccaagcgcct
gttaaaatgcggatttttaataatgacgggtctgaagggaaaaactgcggcaacggcctg
cgctgcgtcgcaaaatacgcatatgagcataagctggttgaggaaacatcttttctgatt
gaaactctctccgggcttgtgaaagcggaggttcaagtcgaaaacggaaaagtgaatgtg
gtcactgtcgatatgggcgaaccgcgcttgacaaaatccgagcttcctatgcttgacggc
ggggaagagcacacaatcaatgaaacgatggcatttggtgaagtagaactaacaggcact
gccgtttcaatgggaaatccgcatatcgtttttccgatcgcagacattgaacaggcaccc
ttaacgacactggggccggtgattgagaaagatccgagatttccggaaggcatcaatgtg
gaattcgttgaaaccgtgaatgaacaagaattgcatttccgcgtctgggaacggggatca
gggattactcaggcatgcgggacaggagcatgtgcagcggcagtcgcatctgtattaaac
ggcgtatcaaagcgaaatcaagacatcacggtgcatttagcaggcggggatttggtgata
aactggaaagataacggccatgtaatgatgacagggccggctgaaaccgtttgtgagggt
gtctatttcttgtaa

DBGET integrated database retrieval system