KEGG   Bacillus subtilis subsp. subtilis 168: BSU33590Help
Entry
BSU33590          CDS       T00010                                 

Gene name
yvaG
Definition
(RefSeq) oxidoreductase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short adh_short_C2 KR Epimerase Polysacc_synt_2 THF_DHG_CYH_C Shikimate_DH GDP_Man_Dehyd Wax2_C
Motif
Other DBs
NCBI-GeneID: 936172
NCBI-ProteinID: NP_391239
Pasteur: BG14063
BSORF: BG14063
UniProt: O32229
LinkDB All DBs
Position
complement(3449732..3450526)
Genome map
AA seq 264 aa AA seqDB search
MKLNLQGKTALVTGSTSGIGKAIASSLAEEGAAVIINGRREEKVNQTIDELKTQHAEAVL
YPAAFDLGTEEGCNELFQAYPEVDILVNNLGIFEPAEYFDIPDDEWFRFFEVNIMSGVRL
TRRYLHNMIEKKEGRVIFIASEAAIMPSQEMAHYSATKTMQLSISRSLAELATGTNVTVN
TVMPGSTLTEGVETMLNSLYPGENLTVQEAEARFMKENRPTSIIQRLIRPEEIAHFVTFL
SSPLSSAINGAALRADGGLVRSVF
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgaatttacaaggaaaaaccgcactggtgaccggttcgacatcagggatcgga
aaagctattgcctcttcgttagctgaagaaggtgcggcagtgatcattaacggacgccgg
gaagagaaagtgaatcaaacgatagatgaactgaaaacacaacatgctgaagcggttctt
tatccggctgcatttgatttgggaacagaagaaggctgcaatgagctgtttcaggcatat
ccagaggttgatattttggtcaacaatttagggatttttgaaccggcggagtactttgat
attcccgacgatgaatggtttcgtttttttgaagtgaatattatgagcggtgtaaggctg
acacgcaggtatttgcataacatgatagagaaaaaagaagggcgtgtgattttcattgcc
agtgaagcggcgattatgccgtcacaggaaatggcccattacagtgcgacaaaaacgatg
cagctgtccatttcccgcagtttggcggagctggcaaccggcacgaatgtcacagtcaac
accgtcatgccgggctctaccttaacagagggtgtggaaaccatgctgaactcgctgtat
cctggtgaaaacctgactgttcaagaagctgaggcacgttttatgaaagaaaaccggccg
acatctattattcaaagactgatccgtccggaagaaatcgcccacttcgttacattttta
agcagtccgctttcctctgcgatcaatggcgcggcacttcgggcggacggcggtttggtc
cgcagtgtcttttaa

DBGET integrated database retrieval system