KEGG   Bacillus subtilis subsp. subtilis 168: BSU33640
Entry
BSU33640          CDS       T00010                                 

Gene name
yvaM
Definition
(RefSeq) AB hydrolase superfamily protein YvaM
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Abhydrolase_1 Hydrolase_4 Abhydrolase_6 Thioesterase LIP Ndr Abhydrolase_2
Other DBs
NCBI-GeneID: 938476
NCBI-ProteinID: NP_391244
Pasteur: BG14068
BSORF: BG14068
UniProt: O32234 A0A6M3ZGN1
LinkDB
Position
3455472..3456242
AA seq 256 aa
MPLISIDSRKHLFYEEYGQGIPIIFIHPPGMGRKVFYYQRLLSKHFRVIFPDLSGHGDSD
HIDQPASISYYANEIAQFMDALHIDKAVLFGYSAGGLIAQHIGFTRPDKVSHLILSGAYP
AVHNVIGQKLHKLGMYLLEKNPGLLMKILAGSHTKDRQLRSILTDHMKKADQAHWHQYYL
DSLGYNCIEQLPRLEMPMLFMYGGLRDWTFTNAGYYRRSCRHAEFFRLEYQGHQLPTKQW
KTCNELVTGFVLTHHS
NT seq 771 nt   +upstreamnt  +downstreamnt
atgccgcttatcagcatagacagcaggaaacatcttttttatgaagaatatggacaggga
atccctatcatttttatccacccgccgggcatgggacgaaaggttttttattatcagcgc
cttctatccaagcatttcagggtgatttttccggatttaagtggccacggtgatagtgat
cacatcgatcagccagcgtctatttcctattacgcaaacgagatcgcgcaattcatggac
gctttgcacattgataaagctgtgttattcgggtattctgccggaggcttaatcgcgcag
catatcggcttcacccgcccggacaaagtgtcacaccttattctgtccggcgcctacccc
gctgttcataacgtaatcggccagaagctgcacaaactgggaatgtatctgcttgaaaaa
aaccccggtttgctcatgaaaatcctcgctggcagccacacaaaagacagacagcttcgc
agcatattaacagaccatatgaaaaaagcagaccaggcccattggcatcagtattatctg
gattcgcttggctacaactgcattgaacagctgccccgcctagaaatgccaatgctgttt
atgtatggcggcctgcgggactggacctttacaaacgcaggctattaccgaagatcgtgc
agacatgccgaatttttcagattggaatatcagggacatcaattgccgacaaaacaatgg
aaaacgtgcaatgagctggtgacagggtttgtgctgacacatcattcatag

DBGET integrated database retrieval system