KEGG   Bacillus subtilis subsp. subtilis 168: BSU33660
Entry
BSU33660          CDS       T00010                                 
Symbol
rghRA
Name
(RefSeq) HTH-type transcriptional repressor RghR
  KO
K22299  HTH-type transcriptional regulator, competence development regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU33660 (rghRA)
Transcription factors [BR:bsu03000]
 Prokaryotic type
  Helix-turn-helix
   Other families
    BSU33660 (rghRA)
SSDB
Motif
Pfam: HTH_31 HTH_3 HTH_19 HTH_26 HTH_25 MarR_2 HTH_37 HTH_5 LacI YycC
Other DBs
NCBI-GeneID: 936180
NCBI-ProteinID: NP_391246
Pasteur: BG14069
UniProt: O32236 A0A6M4JP87
LinkDB
Position
3456667..3457074
AA seq 135 aa
MESFGEQLRALREERKLTVNQLATYSGVSAAGISRIENGKRGVPKPATIKKLAEALKIPY
EGLMYKAGYIEEVHEARAPYETKCKLLEKAEAYDLKNLALLENEKWQYLNKEDLLMLDHY
FSFISDEAKKRSADD
NT seq 408 nt   +upstreamnt  +downstreamnt
atggaaagctttggcgaacaattacgggcattgcgtgaagagagaaagttaacagtcaac
cagctggcgacttattcaggcgtaagcgcggccggcatctccagaatcgaaaacggaaaa
cggggcgttcccaaacctgccaccatcaaaaaactggcagaggccttaaaaattccttat
gaggggcttatgtacaaggctggttacatcgaagaagtgcatgaagccagggccccttat
gaaacgaagtgcaagctgcttgaaaaagcggaggcctatgacctgaaaaaccttgcgctt
cttgagaacgaaaagtggcaatatctcaataaagaagatttgctcatgctggatcattat
ttttcgtttatttcagatgaagcgaaaaaacggtctgctgatgactga

DBGET integrated database retrieval system