KEGG   Bacillus subtilis subsp. subtilis 168: BSU33850
Entry
BSU33850          CDS       T00010                                 
Symbol
yvbG
Name
(RefSeq) hypothetical protein
  KO
K05595  multiple antibiotic resistance protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU33850 (yvbG)
Transporters [BR:bsu02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   BSU33850 (yvbG)
SSDB
Motif
Pfam: MarC TMEM101 DUF809
Other DBs
NCBI-GeneID: 938636
NCBI-ProteinID: NP_391265
Pasteur: BG14080
UniProt: O32244 A0A6M4JPA9
LinkDB
Position
complement(3471841..3472476)
AA seq 211 aa
MMFSFIVHVFISLFAVSNPIGNVPIFLTLTEGYTAAERKAIARKAAILSFFILAAFLVFG
HLIFKLFDINIHALRVAGGIFIFGIAYNLLNAKESHVQSLHHDEHKESKEKADISVTPLS
IPIIAGPGTIATVMSLSAGHSGIGHYAAVMIGIAAVIALTFLFFHYSAFISSKLGKTEMN
VITRLMGLILAVVAVGMIGAGLKGMFPVLTS
NT seq 636 nt   +upstreamnt  +downstreamnt
atgatgttctcatttatcgttcacgtcttcatttctttattcgcagtatcgaatccgatc
ggaaacgtaccgatatttctgacgctgacagaaggctatactgcagcggaaagaaaagcg
attgcccggaaggcagctattttatccttttttattctcgcagcttttttggttttcggt
catcttatctttaaactgtttgatatcaacattcacgcgctccgagtggcgggcggcata
ttcattttcggcattgcctataatctattgaatgcgaaagaatcgcacgtgcaatctctt
caccatgatgaacataaggaaagcaaggaaaaagcggatatatcagtcacacctttatcc
attccgatcattgctgggcccggaacgattgcaacagtgatgagcctttccgccggacat
agcggcattggtcattatgcggctgtcatgatcggcatagccgccgttattgccctgacc
tttctctttttccactattctgcttttatcagcagcaaactcggaaaaaccgagatgaat
gtgattaccagactgatgggattaatcttagccgtggttgcggtcgggatgattggtgcc
gggctgaaaggcatgtttccggtcttaacttcatga

DBGET integrated database retrieval system