KEGG   Bacillus subtilis subsp. subtilis 168: BSU34160
Entry
BSU34160          CDS       T00010                                 
Symbol
cycB
Name
(RefSeq) cyclodextrin-binding protein
  KO
K15770  arabinogalactan oligomer / maltooligosaccharide transport system substrate-binding protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU34160 (cycB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU34160 (cycB)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Arabinogalactan oligomer/maltooligosaccharide transport system
    BSU34160 (cycB)
SSDB
Motif
Pfam: SBP_bac_8 SBP_bac_1 SBP_bac_6 SBP_bac_11
Other DBs
NCBI-GeneID: 936329
NCBI-ProteinID: NP_391296
Pasteur: BG12436
UniProt: O07009 A0A6M4JPD8
LinkDB
Position
complement(3507253..3508518)
AA seq 421 aa
MKMAKKCSVFMLCAAVSLSLAACGPKESSSAKSSSKGSELVVWEDKEKSNGIKDAVAAFE
KEHDVKVKVVEKPYAKQIEDLRMDGPAGTGPDVLTMPGDQIGTAVTEGLLKELHVKKDVQ
SLYTDASIQSQMVDQKLYGLPKAVETTVLFYNKDLITEKELPKTLEEWYDYSKKTADGSK
FGFLALFDQIYYAESVMSGYGGYIFGKAKDGSYNPSDIGINNEGAVKGAALIQKFYKDGL
FPAGIIGEQGINVLESLFTEGKAAAIISGPWNVEAFSNAGINYGITKLPKLENGKNMSSF
IGVKSYNVSAFSKNEELAQELAVFLANEKNSKTRYEETKEVPAVKSLANDPAIMKSEAAR
AVTEQSRFSEPTPNIPEMNEIWTPADSALQTVATGKADPKQALDQAAETAKGQIKAKHSG
K
NT seq 1266 nt   +upstreamnt  +downstreamnt
atgaaaatggcaaaaaagtgttccgtattcatgctctgcgcagctgtcagtttatccttg
gcggcttgcggcccaaaggaaagcagcagcgccaaatcgagttcaaaagggtcagagctt
gttgtatgggaggataaagaaaagagcaacggcattaaagacgctgtggctgcatttgaa
aaagagcatgatgtgaaggtcaaagtcgttgaaaaaccgtatgccaagcagattgaagat
ttgcgaatggatggaccggccggcacaggccctgacgtgttaacaatgccaggggaccaa
atcggaaccgctgtcacggaaggattactcaaggaattacatgtcaaaaaagacgttcaa
tcactttatactgacgcttccattcagtctcaaatggtagatcaaaagctttatggactg
ccaaaagcggtcgaaacgactgtgcttttttacaacaaagatctcatcacagaaaaggaa
ttgcccaaaacgctggaagagtggtacgactattccaaaaagactgctgacggcagcaaa
tttggctttttagccctattcgatcaaatttattatgcagaaagtgtgatgagcggatat
ggcggatacatttttggaaaggccaaagatgggagctataacccgtcagacattggaatc
aataatgaaggagctgtcaaaggtgcggcgctgattcagaagttttacaaagatggcctg
ttcccggctggcattattggagaacaagggattaacgtgttggaatcgctgttcacagaa
ggaaaagccgccgcaattatttctggtccatggaatgtagaagccttttcgaatgcagga
atcaattatggcattacgaaactgccgaagctggaaaatgggaaaaacatgagctccttt
atcggcgtcaaaagctacaacgtcagtgcattttcaaagaatgaagagctggcgcaagaa
ttagccgttttcctggcaaatgaaaaaaattctaaaacacgatatgaagaaacgaaagaa
gttcctgctgtgaaatccctagccaatgacccggctattatgaaaagcgaggcggcacgg
gctgttactgaacaatcccgtttctcagagccaacaccaaatattccggaaatgaatgaa
atatggacgccggctgattcagcattacagacggttgcaacagggaaggcagatccgaaa
caagcattggatcaagcagctgaaacggccaaaggacaaattaaggcaaagcacagcgga
aaataa

DBGET integrated database retrieval system