KEGG   Bacillus subtilis subsp. subtilis 168: BSU34230
Entry
BSU34230          CDS       T00010                                 

Gene name
epsN
Definition
(RefSeq) pyridoxal phosphate-dependent aminotransferase EpsN
  KO
K19430  pyridoxal phosphate-dependent aminotransferase EpsN [EC:2.6.1.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU34230 (epsN)
Enzymes [BR:bsu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.-  
     BSU34230 (epsN)
SSDB
Motif
Pfam: DegT_DnrJ_EryC1 Beta_elim_lyase Aminotran_1_2 SepSecS Cys_Met_Meta_PP Aminotran_5 Pyridoxal_deC DUF4186
Other DBs
NCBI-GeneID: 936364
NCBI-ProteinID: NP_391303
Pasteur: BG11873
BSORF: BG11873
UniProt: Q795J3 A0A6M3ZH60
LinkDB
Position
complement(3515062..3516228)
AA seq 388 aa
MHKKIYLSPPHMSGREQHYISEAFRSNWIAPLGPLVNSFEEQLAERVGVKAAAAVGSGTA
AIHLALRLLEVKEGDSVFCQSFTFVATANPILYEKAVPVFIDSEPDTWNMSPTALERALE
EAKRNGTLPKAVIAVNLYGQSAKMDEIVSLCDAYGVPVIEDAAESLGTVYKGKQSGTFGR
FGIFSFNGNKIITTSGGGMLVSNDEAAIEKARFLASQAREPAVHYQHSEIGHNYRLSNIL
AGVGIAQLEVLDERVEKRRTIFTRYKNALGHLDGVRFMPEYAAGVSNRWLTTLTLDNGLS
PYDIVQRLAEENIEARPLWKPLHTQPLFDPALFYSHEDTGSVCEDLFKRGICLPSGSNMT
EDEQGRVIEVLLHLFHTVEVKKWTASIR
NT seq 1167 nt   +upstreamnt  +downstreamnt
atgcataaaaaaatctacttatctccccctcatatgagcggcagggagcagcactatatt
tcagaagcctttcgctcaaactggattgcgccgcttgggccgctcgtgaattcatttgaa
gaacagctggcagaacgagtcggtgtaaaagcagcagctgcggtcggctcaggaacggcg
gcgattcatctcgcgctgcgtttgcttgaggtaaaagaaggtgacagcgtgttttgccag
tccttcacatttgtagcaaccgccaatccgattctatatgaaaaagcggtgcccgtcttt
attgattctgagcctgatacgtggaatatgtcgccgacagcccttgaaagagcattggag
gaagcgaaaagaaacggaacactgccaaaagcggtaattgccgtcaatctatatgggcag
agcgcgaaaatggatgaaatcgtaagcctgtgtgatgcatacggagttcctgtcattgag
gacgcagccgaatctctcggcacagtctataaagggaagcaaagcggaacattcgggcgc
ttcggcattttttcatttaacgggaacaaaatcatcaccacatcagggggagggatgctc
gtttcaaatgatgaagccgcaattgaaaaagcaagatttctcgcttcgcaggcacgagag
ccggctgttcattatcagcacagtgaaattggacataattacaggctgagcaatatctta
gccggcgtcggcattgcccagcttgaggtgctggatgagcgagtggagaaaagaaggacc
attttcacgagatacaaaaatgcgctcggtcacttagacggcgtccgctttatgccagag
tacgcagcaggcgtatccaatcgctggctcaccacgctcacacttgataacgggctcagc
ccatatgacatagttcaacgtcttgctgaagaaaacattgaagcccgtccgctgtggaag
ccgctccatacccagccgctgttcgatccggctttattttattctcatgaagatacagga
agcgtatgcgaagatttgttcaagcgaggaatctgtctcccatcggggtccaatatgaca
gaagatgagcaaggccgggtcattgaagtgctactgcacttattccatactgtcgaggtg
aagaaatggacagcaagcattcgatga

DBGET integrated database retrieval system