KEGG   Bacillus subtilis subsp. subtilis 168: BSU34710
Entry
BSU34710          CDS       T00010                                 

Gene name
yvcQ
Definition
(RefSeq) sensor histidine kinase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: HATPase_c HisKA HATPase_c_2 HATPase_c_3
Other DBs
NCBI-GeneID: 938024
NCBI-ProteinID: NP_391351
Pasteur: BG12406
BSORF: BG12406
UniProt: O06979 A0A6M3ZGA7
LinkDB
Position
complement(3566358..3567428)
AA seq 356 aa
MLKTYLIDRLAIILFSLLGIGSAMLIAYLSIVESGAEPSKENMMYIWILPGTLLAAGFAA
DYVRQFSFLTYVKKLAEQASSSNDIGQSLKARKPRTGEQALWTKMINALGQQYESRLSQY
INQQKQHYTFTNQWVHHMKTPVSVISLMIQEGKNGTSSSFPTFLEELEDENERFRHGLDM
MLQTARLEEFAFDVKPQTFDLAEMVRSLINQEKRQFIKRRLFPTLHVPPNAVQISSDQKW
LSFVVEQILFNALKYSKQGVGDPITIRIETQGHETRLSVADEGIGIPPQDLPRIFDAFFT
GENGRTMKEATGMGLYLAKQVCSRLGHKLYAESKEGAGTVMTIVFSSDTLVNVTAL
NT seq 1071 nt   +upstreamnt  +downstreamnt
atgttaaagacttatctcatcgaccgcttagccattattctattttcattattagggata
gggtccgccatgctgattgcgtatttaagcattgtagagagcggcgcagaaccttccaaa
gaaaatatgatgtacatatggattttgcccggtactcttttagccgcaggttttgctgct
gattatgttcggcaattttcctttctcacatatgttaaaaagcttgcagaacaagcctct
tcttcgaatgacatcggacagtctttgaaagccagaaagccaagaacaggagagcaagcg
ctttggacgaagatgatcaacgcactcgggcagcaatacgaaagcaggctctcacaatat
atcaatcagcaaaaacagcattacaccttcaccaaccaatgggtccaccatatgaaaaca
ccggtatctgtcatatccttaatgattcaggaaggaaaaaacggaacctcatcctctttt
ccgacgtttttagaggagctggaggatgagaatgagagatttcgccacggtcttgatatg
atgctgcaaacggcccggctggaggaatttgcatttgatgtaaagccgcaaacctttgat
ttggcagaaatggttcgttcactgatcaatcaggaaaaacgtcagtttatcaagcggcgc
ctttttccaacattacatgtgccgccaaatgccgttcagatttccagtgatcaaaagtgg
ctttcctttgttgttgagcaaatccttttcaacgccttaaaatattcaaagcaaggtgtg
ggagaccctattacaatccggattgaaacacagggacatgagacgcgcttgtcggttgcc
gacgaaggaatcggcataccgccgcaggatctgccgcggatttttgacgcgttttttacc
ggagaaaacggacgaaccatgaaagaggcaactggaatgggcctttatttagcaaaacag
gtgtgcagccgtctcggccataagctgtatgcggaatcaaaagaaggggctggcactgtg
atgaccatcgtgttttcaagtgacaccctcgtgaatgtgacagcattgtaa

DBGET integrated database retrieval system