KEGG   Bacillus subtilis subsp. subtilis 168: BSU34780Help
Entry
BSU34780          CDS       T00010                                 

Gene name
yvcI
Definition
(RefSeq) Nudix hydrolase YvcI
  KO
K03574  8-oxo-dGTP diphosphatase [EC:3.6.1.55]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bsu03400]
    BSU34780 (yvcI)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.55  8-oxo-dGTP diphosphatase
     BSU34780 (yvcI)
DNA repair and recombination proteins [BR:bsu03400]
 Eukaryotic Type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    BSU34780 (yvcI)
 Prokaryotic Type
    BSU34780 (yvcI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NUDIX NUDIX_4
Motif
Other DBs
NCBI-GeneID: 936528
NCBI-ProteinID: NP_391358
Pasteur: BG12399
BSORF: BG12399
UniProt: O06972
LinkDB All DBs
Position
complement(3572413..3572889)
Genome map
AA seq 158 aa AA seqDB search
MTYLQRVTNCVLQTDDKVLLLQKPRRGWWVAPGGKMESGESVRDSVIREYREETGIYIIN
PQLKGVFTFIIKDGDHIVSEWMMFTFVADSYTGQNVSESEEGKLQWHDVNDIQNLPMAPG
DGHILDFMMKGQGLLHGTFTYTPEFELLSYRLDPQHIK
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
gtgacgtacttgcaaagagtgacaaattgtgtgcttcagacggatgacaaagttcttctg
cttcaaaagccgagacgcggatggtgggtcgcgccgggaggcaagatggagagcggagaa
tcagtcagagactccgtcatcagagagtacagagaagagactggtatctatatcataaat
cctcaattaaaaggcgtttttacctttattattaaagacggtgaccacattgtctccgag
tggatgatgtttacgtttgtcgctgattcatatacaggacaaaatgtatcagaatcagag
gaaggcaaactgcagtggcacgatgtcaatgacattcagaacctgcctatggcccctgga
gacggccatatccttgattttatgatgaagggacaagggctgctgcacggcacatttacg
tatacaccggaatttgagctgctcagttatcgtttagacccgcagcacatcaaatag

DBGET integrated database retrieval system