KEGG   Bacillus subtilis subsp. subtilis 168: BSU36470
Entry
BSU36470          CDS       T00010                                 

Gene name
pucI
Definition
(RefSeq) allantoin permease
  KO
K03457  nucleobase:cation symporter-1, NCS1 family
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    BSU36470 (pucI)
SSDB
Motif
Pfam: Transp_cyt_pur
Other DBs
NCBI-GeneID: 936935
NCBI-ProteinID: NP_391528
Pasteur: BG12492
BSORF: BG12492
UniProt: P94575 A0A6M3ZLA5
LinkDB
Position
complement(3752280..3753752)
AA seq 490 aa
MKLKESQQQSNRLSNEDLVPLGQEKRTWKAMNFASIWMGCIHNIPTYATVGGLIAIGLSP
WQVLAIIITASLILFGALALNGHAGTKYGLPFPVIIRASYGIYGANIPALLRAFTAIMWL
GIQTFAGSTALNILLLNMWPGWGEIGGEWNILGIHLSGLLSFVFFWAIHLLVLHHGMESI
KRFEVWAGPLVYLVFGGMVWWAVDIAGGLGPIYSQPGKFHTFSETFWPFAAGVTGIIGIW
ATLILNIPDFTRFAETQKEQIKGQFYGLPGTFALFAFASITVTSGSQVAFGEPIWDVVDI
LARFDNPYVIVLSVITLCIATISVNVAANIVSPAYDIANALPKYINFKRGSFITALLALF
TVPWKLMESATSVYAFLGLIGGMLGPVAGVMMADYFIIRKRELSVDDLYSETGRYVYWKG
YNYRAFAATMLGALISLIGMYVPVLKSLYDISWFVGVLISFLFYIVLMRVHPPASLAIET
VEHAQVRQAE
NT seq 1473 nt   +upstreamnt  +downstreamnt
atgaaattaaaagagagtcagcagcaatccaacaggctgagcaatgaagatctggtgcct
ttgggacaggaaaaacggacgtggaaagcaatgaactttgcctccatttggatgggatgt
atacataacataccgacctacgcgaccgtgggaggattaattgcgatcggcctttcgcct
tggcaggtgctggcgatcattattacggcatcacttatcctatttggcgctcttgcctta
aacggccatgcggggacaaaatacgggctgccgtttccagtgatcattcgggcttcttac
gggatatacggcgcgaatatccccgcgcttctaagggcgtttacagctatcatgtggctt
ggcatccagacctttgcgggtagcacggcactgaacattttgcttttgaatatgtggcca
ggttggggagaaattggcggcgagtggaacattctcggcattcacttgtccggtttgctt
tcctttgtattcttttgggccattcatttactcgtattgcatcacggcatggagtcgatt
aaacgttttgaggtgtgggcagggcctttagtgtatctggtatttggcggcatggtatgg
tgggccgttgatattgctggaggattgggcccgatatactctcaaccaggaaagtttcat
acgttttcagaaacattctggccgtttgctgccggagttactggcatcatcggcatctgg
gcgacattgatcttaaatatacctgattttacacggtttgctgaaacacaaaaagagcaa
atcaaaggacaattttacggtttgccgggaacgtttgcgctgttcgcattcgcaagtatt
acggtgacctccggctcgcaggtcgcgttcggagagccgatttgggatgttgtcgatatt
ttggcgcggtttgataacccttatgtcatcgtcttgtccgtgatcacactctgcatcgcc
acgatctctgtaaatgtcgcggcgaatatcgtatcacccgcttatgatatagcgaatgcc
ctgccgaaatatatcaatttcaaacgtggcagctttatcacagcgttgctcgctttattt
acggttccgtggaagctgatggagagcgcgacaagcgtgtatgcgtttcttggcttaata
ggcggcatgcttggaccggtggcaggcgtgatgatggccgactattttatcattcgcaaa
cgtgagctctcggtagatgacctgtattccgaaacaggacggtatgtgtattggaagggc
tacaattaccgtgcgtttgcagccacaatgttaggagcgctgatttcgctgattggcatg
tatgttcctgtattgaagagcttatacgatatttcttggtttgtaggtgtgctgatttcc
tttcttttctacattgttctgatgcgtgttcacccgcctgcatcattggcaattgaaaca
gttgaacatgcgcaggtccgccaggctgaataa

DBGET integrated database retrieval system