KEGG   Bacillus subtilis subsp. subtilis 168: BSU36840
Entry
BSU36840          CDS       T00010                                 

Symbol
atpH
Name
(RefSeq) ATP synthase subunit delta
  KO
K02113  F-type H+-transporting ATPase subunit delta
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00190  Oxidative phosphorylation
bsu01100  Metabolic pathways
Module
bsu_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BSU36840 (atpH)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:bsu00194]
    BSU36840 (atpH)
Photosynthesis proteins [BR:bsu00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   BSU36840 (atpH)
SSDB
Motif
Pfam: OSCP DUF4284
Other DBs
NCBI-GeneID: 936997
NCBI-ProteinID: NP_391565
Pasteur: BG10818
BSORF: BG10818
UniProt: P37811 A0A6M3ZH54
LinkDB
Position
complement(3785403..3785948)
AA seq 181 aa
MSGSAVSKRYASALFDIANESAQLNQVEEELIVVKQVFQNEKALNDVLNHPKVPAAKKKE
LIQNAFGSLSQSVLNTIFLLIDRHRAAIVPELTDEFIKLANVARQTEDAIVYSVKPLTDA
EMLPLSQVFAKKAGVASLRIRNEVQTDLIGGIKVRIGNRIYDGSVSGKLQRIERQLAGEN
R
NT seq 546 nt   +upstreamnt  +downstreamnt
atgagtggatcagctgtctctaaacgatatgcatcagctctttttgatatagccaatgag
tccgctcagctgaatcaagtagaagaagagctaattgttgtaaaacaagtatttcaaaat
gaaaaagcgcttaatgatgtgttgaaccatccgaaggtgccggctgcgaagaaaaaagag
ctgattcaaaatgcatttggctctttgtcacagtccgtactcaatacgatttttcttttg
attgaccgccatcgtgccgcgattgtccctgagctcacagatgagtttatcaaactcgca
aatgtggcccgtcaaacagaagacgcaatcgtatattcagtgaaaccgctgacggatgca
gaaatgttaccattatcacaagtgtttgcaaaaaaagccggagtcgcttcactgagaatc
agaaatgaagtgcagacggatttaataggcggtattaaagtccgcattggaaaccggatt
tatgacggcagcgtaagcgggaagcttcagcgcattgaacgtcaattagccggggaaaat
cgatag

DBGET integrated database retrieval system