KEGG   Bacillus subtilis subsp. subtilis 168: BSU37460
Entry
BSU37460          CDS       T00010                                 

Gene name
rapF
Definition
(RefSeq) response regulator aspartate phosphatase F
  KO
K06364  response regulator aspartate phosphatase F [EC:3.1.-.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BSU37460 (rapF)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     BSU37460 (rapF)
SSDB
Motif
Pfam: RapH_N TPR_12 TPR_2 TPR_1 ANAPC3 TPR_8 TPR_16 TPR_7 TPR_MalT TPR_19 TPR_6 SNAP Ribonuclease_T2 SPO22
Other DBs
NCBI-GeneID: 936725
NCBI-ProteinID: NP_391626
Pasteur: BG11968
BSORF: BG11968
UniProt: P71002 A0A6M4JQ97
LinkDB
Structure
PDB: 
3ULQ 4I9E 4I9C

Position
3846001..3847146
AA seq 381 aa
MTGVISSSSIGEKINEWYMYIRRFSIPDAEYLRREIKQELDQMEEDQDLHLYYSLMEFRH
NLMLEYLEPLEKMRIEEQPRLSDLLLEIDKKQARLTGLLEYYFNFFRGMYELDQREYLSA
IKFFKKAESKLIFVKDRIEKAEFFFKMSESYYYMKQTYFSMDYARQAYEIYKEHEAYNIR
LLQCHSLFATNFLDLKQYEDAISHFQKAYSMAEAEKQPQLMGRTLYNIGLCKNSQSQYED
AIPYFKRAIAVFEESNILPSLPQAYFLITQIHYKLGKIDKAHEYHSKGMAYSQKAGDVIY
LSEFEFLKSLYLSGPDEEAIQGFFDFLESKMLYADLEDFAIDVAKYYHERKNFQKASAYF
LKVEQVRQLIQGGVSLYEIEV
NT seq 1146 nt   +upstreamnt  +downstreamnt
gtgacaggtgtcatatcttcttcttccatcggagaaaagattaacgaatggtatatgtac
atacgccgattcagcatacccgatgcagaatatttgcgacgagaaatcaagcaagagctg
gatcaaatggaagaagatcaagaccttcatttgtactattcactgatggagtttcggcac
aacctaatgcttgagtaccttgaaccgttagaaaaaatgaggattgaggaacagccgaga
ctgtctgatctgctgcttgagattgataaaaaacaggctcgtttaactggtctgcttgag
tactattttaacttcttcagaggcatgtacgagctggaccagcgggaatatctgtcggct
attaaatttttcaaaaaggccgaaagcaagctgatattcgttaaggatcggatagagaaa
gctgagtttttctttaagatgtctgaatcttattactatatgaaacaaacgtatttttca
atggactatgcacggcaagcatatgaaatatacaaagaacatgaagcttataatataaga
ttgctgcagtgtcattctttatttgccaccaattttttagatttaaaacagtatgaggat
gccatctcacattttcaaaaagcttattctatggcagaagctgaaaagcagccccaatta
atggggagaactttgtacaatatcgggctttgtaaaaacagccaaagccaatatgaggat
gccataccttatttcaaaagagcaatagctgtttttgaagaatcaaatattcttccttcc
ttacctcaagcgtattttttaattacacagatccattataaattaggaaaaatagataaa
gctcatgaatatcatagtaagggaatggcttattcacaaaaggccggagatgtaatatat
ttatcagagtttgaatttttgaaatctttatacttatcaggcccggatgaagaagcaatt
caaggattttttgattttctcgaaagtaaaatgttgtatgctgatcttgaagatttcgct
attgatgtggcaaaatattatcatgaacgtaaaaattttcaaaaagcttctgcttatttt
ttgaaggtggaacaagtaaggcaacttattcaaggaggagtgagtttgtatgaaattgaa
gtctaa

DBGET integrated database retrieval system