KEGG   Bacillus subtilis subsp. subtilis 168: BSU37570Help
Entry
BSU37570          CDS       T00010                                 

Gene name
mmr
Definition
(RefSeq) methylenomycin A resistance protein
  KO
K08166  MFS transporter, DHA2 family, methylenomycin A resistance protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU37570 (mmr)
Transporters [BR:bsu02000]
 Major facilitator superfamily (MFS)
  Drug transporters
   Drug:H+ antiporter-2 (14 spanner) (DHA2) family [TC:2.A.1.3]
    BSU37570 (mmr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 PDR_CDR
Motif
Other DBs
NCBI-GeneID: 937101
NCBI-ProteinID: NP_391637
Pasteur: BG10420
BSORF: BG10420
UniProt: Q00538
LinkDB All DBs
Position
complement(3857017..3858417)
Genome map
AA seq 466 aa AA seqDB search
MKNSGSIQESTSSTGISVLIVLALGFLMATLDVTVVNVAMADMKNTLSMSLSGVTWVVDG
YILTFASLLLAGGALADRFGSKTIYILGLAVFVMASCLCAASINGQMLIAGRLIQGIGAA
LFMPSSLSLLAASYLDERARARMFGLWAALVSAASALGPFIGGVLVQLAGWQSIFLINVP
IGAAALISAYRILSRVPGKSSRVNIIGHLLGMMALGFLSYALIQGPSAGWRSPVILVAFT
AAVLAFVLFLLREISAKTPILPASLYKNGRFSAAQFIGFLLNFALFGGMFMLSLFLQEAG
GASSFMAGVELLPMMAVFVIGNLLFARLANRFEAGQLMFVSMAVSCIIALLLFVLISPDF
PYWQLAVLMSVMNLCTGITVPAMTTVIMQAAGQRHTNIAGAALNANRQIGALVGVAITGV
IIHLSATWYAGAGFAFLMMGAAYSLAALLVWLFLAAHNGTAASEKM
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatagcgggtctatacaagaatcaacatcatcaacaggcatatccgtgctgatc
gtgctcgcacttggtttcctcatggcaactcttgatgtgaccgttgtgaatgtggcgatg
gctgatatgaaaaacactctttcaatgtcactttcaggtgtaacgtgggttgtggacggg
tacattcttacttttgcgtcgcttctgctggcgggcggagccttggctgaccgtttcggc
tcgaagacgatctatatcttgggtctagccgtttttgttatggcctcctgtctatgcgct
gcatctataaatgggcagatgctgattgccggacgtctcatacagggaattggggcagct
ttgtttatgccaagctcactcagccttttggctgcctcttaccttgatgagcgggcgcgg
gcgagaatgtttggactgtgggccgcgcttgtttccgccgcttcagcccttgggcctttt
atcgggggcgtgctggtacagttggcgggctggcagagtatttttctgatcaatgtgcca
ataggggctgctgcgctcatttcagcttaccgaatcctcagccgcgttcctgggaaaagc
agccgcgtgaacatcatcgggcatctgcttggcatgatggctctcgggtttctttcctat
gctttgatacaggggccttcagcgggctggcgctcgccagtgattcttgtagcatttact
gcagcggttttggcatttgtgctgtttttgctgcgggaaatttctgcaaaaacacccatc
ctgccggcgtccttatacaaaaacggccgcttctcagctgcccaatttatcgggtttttg
ctgaatttcgccctttttggcggcatgtttatgctcagcctttttttgcaggaagcagga
ggggcaagttcctttatggctggagtggagctgctgccgatgatggcggtcttcgtgatc
ggcaatctgctgtttgcccgtctggcgaatcggtttgaagccggtcagcttatgtttgta
tcaatggcggtcagctgtatcattgcattgctgttgtttgtgctgatttctccggatttt
ccttattggcagctggcggtgttgatgtctgttatgaacctctgtaccggtattacagtt
cctgccatgacaactgtgatcatgcaggctgccgggcaaagacatacgaatatcgccggt
gcggcgttaaatgcaaaccggcaaatcggagccttggtcggcgtagcgataaccggggtg
atcattcatctgtccgccacttggtatgctggtgccgggtttgcgtttttgatgatggga
gcggcatacagcctcgctgcattgcttgtatggctgtttctggctgcccataacgggact
gccgcgtcagaaaaaatgtaa

DBGET integrated database retrieval system