KEGG   Bacillus subtilis subsp. subtilis 168: BSU37690
Entry
BSU37690          CDS       T00010                                 

Gene name
ywfG
Definition
(RefSeq) aspartate aminotransferase
  KO
K19549  bacilysin biosynthesis transaminase BacF [EC:2.6.1.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00998  Biosynthesis of various secondary metabolites - part 2
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
Module
bsu_M00787  Bacilysin biosynthesis, prephenate => bacilysin
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various secondary metabolites - part 2
    BSU37690 (ywfG)
Enzymes [BR:bsu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.-  
     BSU37690 (ywfG)
SSDB
Motif
Pfam: Aminotran_1_2 Alliinase_C Cys_Met_Meta_PP
Other DBs
NCBI-GeneID: 937157
NCBI-ProteinID: NP_391649
Pasteur: BG10631
BSORF: BG10631
UniProt: P39643 A0A6M3ZK57
LinkDB
Position
complement(3868287..3869486)
AA seq 399 aa
MEITPSDVIKTLPRQEFSLVFQKVKEMEKTGAHIINLGQGNPDLPTPPHIVEALREASLN
PSFHGYGPFRGYPFLKEAIAAFYKREYGVTINPETEVALFGGGKAGLYVLTQCLLNPGDI
ALVPNPGYPEYLSGITMARAELYEMPLYEENGYLPDFEKIDPAVLEKAKLMFLNYPNNPT
GAVADAAFYAKAAAFAKEHNIHLIHDFAYGAFEFDQKPASFLEAEDAKTVGAELYSFSKT
FNMAGWRMAFAVGNEKIIQAVNEFQDHVFVGMFGGLQQAASAALSGDPEHTESLKRIYKE
RIDFFTALCEKELGWKMEKPKGTFYVWAEIPNTFETSHQFSDYLLEHAHVVVTPGEIFGS
NGKRHVRISMVSKQEDLREFVTRIQKLNLPFGSLQETSR
NT seq 1200 nt   +upstreamnt  +downstreamnt
atggaaataacaccgtccgatgtcatcaagacacttccaaggcaggagttttctctcgtt
tttcaaaaggtaaaggaaatggaaaaaacgggagcccatatcattaatctcggacagggg
aaccctgaccttcccactccgccgcatattgtcgaggctttgcgggaggcttctctgaat
ccttcgtttcatggatacggccctttcaggggctatccttttttaaaggaagcgatcgcc
gctttctataaaagggaatacggagtgacaatcaatcctgaaacggaagtcgcgcttttc
ggaggcgggaaagccggattgtatgtgctgacacaatgcctgctcaatccgggagacatc
gctttagtcccgaatccaggctatcctgaatatttatcagggattacgatggcgcgagct
gagctttacgaaatgccgctgtatgaagaaaatggctatctgccggattttgaaaagatt
gatccagccgtgctggaaaaagcgaagcttatgtttttaaactatccgaacaaccccact
ggagctgtggctgatgcggctttttatgcaaaagctgctgcttttgcgaaagagcataac
atccatttgattcatgattttgcatacggggcgtttgaattcgatcaaaaaccggccagc
tttcttgaggcagaggatgccaaaactgtcggagcagagctttattcattttcaaaaaca
tttaacatggccggctggagaatggcgtttgcggttgggaacgaaaaaatcattcaggcc
gtcaatgaatttcaggatcatgtatttgtcggcatgttcggcgggctgcagcaggcagcg
agtgcggcgctttctggagatccggagcatacggaatcgttgaaacgaatttataaggaa
cgaattgacttttttacggcgctttgtgaaaaggaactgggctggaagatggaaaagcca
aaaggaaccttttacgtatgggctgaaattccgaatacgtttgagacatctcaccaattt
tccgattacttgctggagcatgcccatgtcgtagtcacaccgggcgaaatttttggaagc
aacggaaaaaggcatgtcagaatctcaatggtgtcgaagcaggaggatctgcgggaattt
gtcacgcggattcaaaagctgaacctgccgttcgggtcattacaagaaacatcccgctaa

DBGET integrated database retrieval system