KEGG   Bacillus subtilis subsp. subtilis 168: BSU37720Help
Entry
BSU37720          CDS       T00010                                 

Gene name
bacC
Definition
(RefSeq) bacilysin biosynthesis oxidoreductase
  KO
K19548  dihydroanticapsin dehydrogenase [EC:1.1.1.385]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00998  Biosynthesis of various secondary metabolites - part 2
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
Module
bsu_M00787  Bacilysin biosynthesis, prephenate => bacilysin
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various secondary metabolites - part 2
    BSU37720 (bacC)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.385  dihydroanticapsin dehydrogenase
     BSU37720 (bacC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase GDP_Man_Dehyd Polysacc_synt_2 Sacchrp_dh_NADP NAD_binding_7 TrkA_N ADH_zinc_N DUF1776
Motif
Other DBs
NCBI-GeneID: 937065
NCBI-ProteinID: NP_391652
Pasteur: BG10628
BSORF: BG10628
UniProt: P39640
LinkDB All DBs
Structure
PDB: 

Position
complement(3872105..3872872)
Genome map
AA seq 255 aa AA seqDB search
MIMNLTDKTVLITGGASGIGYAAVQAFLGQQANVVVADIDEAQGEAMVRKENNDRLHFVQ
TDITDEAACQHAVESAVHTFGGLDVLINNAGIEIVAPIHEMELSDWNKVLQVNLTGMFLM
SKHALKHMLAAGKGNIINTCSVGGLVAWPDIPAYNASKGGVLQLTKSMAVDYAKHQIRVN
CVCPGIIDTPLNEKSFLENNEGTLEEIKKEKAKVNPLLRLGKPEEIANVMLFLASDLSSY
MTGSAITADGGYTAQ
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgatcatgaacctcaccgataaaaccgtcctcatcacaggaggcgcatcaggcattggt
tatgctgcggttcaggcttttttgggccagcaggccaatgtggttgtggcggatattgat
gaagcgcaaggagaagcaatggtacgaaaagaaaataatgacaggctgcactttgtgcaa
acggacatcacagacgaagctgcctgccagcacgcagttgaatcggcggttcatacattt
ggcgggctcgatgtcttgattaataatgcaggcatcgaaatcgtggcgcctattcacgag
atggagctcagcgattggaacaaggtgctgcaagtcaatttgaccggcatgtttttaatg
agcaaacatgcactcaagcatatgctggccgccggcaagggcaacatcattaatacgtgc
tctgtcggcggactcgtggcatggcctgatattcctgcttataacgccagcaaaggcggg
gttttgcagctgactaaatcaatggccgttgattatgcgaaacatcaaattcgggtgaac
tgcgtatgcccggggatcatcgacacaccgctgaatgaaaaatcattccttgaaaataat
gaaggcacacttgaagagattaaaaaagaaaaagcgaaggtaaatccgctgctgaggctt
gggaaacctgaagaaatcgcaaatgtgatgctgtttttagcctcggatttatcaagctat
atgaccggaagcgccatcaccgcagacggaggatacaccgcacaatag

DBGET integrated database retrieval system