KEGG   Bacillus subtilis subsp. subtilis 168: BSU37750Help
Entry
BSU37750          CDS       T00010                                 

Gene name
ywfA
Definition
(RefSeq) MFS transporter
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr MFS_2 MFS_4 MFS_1_like
Motif
Other DBs
NCBI-GeneID: 937061
NCBI-ProteinID: NP_391655
Pasteur: BG10625
BSORF: BG10625
UniProt: P39637
LinkDB All DBs
Position
complement(3874332..3875570)
Genome map
AA seq 412 aa AA seqDB search
MNSNQNNDIKTKHHFPLLLALALTMGVFAAGSEELVISPLLPDLAKAFSSDVSVLALSIS
IYGVMIFIGAPLLVPLGDKYSRELSLLAGLMIFIIGTVICALAQNIFFFFLGRALSGLAA
GAFVPTAYAVVGDRVPYTYRGKVMGLIVSSWSLALIFGVPLGSFIGGVLHWRWTFWIFAL
MGVLVVLLILLEMRRHAQHKNSGKEEIEEPAGTFRDALKVPRVPVYITITFCNMIGFYGM
YSFLGTYLQDVFTGGNTAAGLFIMIYGIGFSMSVITGKIADRIGKMRSLLIALGVISVLL
ACLPYAPASMFLLIASLFIWGLMQSLTVTLLSTILSDCSERHRGKVMVFYSLASNLAVTL
GSALMGPVYVAYGYAAVGLICAAITVLGFVLSVFAYKKYGKLEQKADQSLSQ
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgaacagcaatcaaaacaatgacatcaaaacaaaacatcattttccgttattgttggca
ctggctttaacgatgggggtatttgcagccggatctgaagagcttgtgatctcaccgctg
ctgccggatttagcaaaagccttcagctcagatgtcagcgtccttgcgttatctatcagt
atttacggcgttatgatttttatcggtgcgccgcttttggttccattaggcgataaatac
tccagagaactgagcttattggccgggcttatgatttttatcataggaacggtgatatgc
gctttagctcaaaatatttttttcttctttttaggccgggcgctttcgggattggctgcg
ggagcgtttgttccgaccgcttacgcagttgtcggtgatcgtgttccttatacataccgg
ggcaaggtgatgggactgatcgtttcaagctggtcgctggcgctgattttcggagtgccg
ctcggatcatttatcggcggcgtcctgcattggagatggacgttttggattttcgccctg
atgggtgttttagttgttctgctgattctccttgaaatgcgccgccatgcccaacataaa
aacagcggcaaggaagaaatagaagagcccgcaggaacattccgggatgcgctgaaagtc
cctcgtgtacctgtttatatcacaataaccttttgtaatatgattggtttttacggtatg
tattcctttttaggcacctatcttcaggacgtttttaccggaggaaacacggctgcgggc
ttatttatcatgatttatggaatcgggttttccatgagtgtgattacaggaaagatagcc
gaccgcatcggaaaaatgcgctcccttttgattgcgctgggggtcatcagcgttctgctg
gcgtgtttaccatatgcgccggcgtctatgtttctgttaatcgccagcctatttatttgg
ggattaatgcaaagtttgacggtgacgctgctcagcaccattttgagtgactgctcagag
cgtcatcgaggaaaagtcatggtgttttacagtctcgcctcgaatctggccgtgacatta
ggttctgctttaatgggacccgtatatgtggcatacggctatgcagctgtcggattgatt
tgcgccgccatcacagtcctcggatttgtgctcagtgtattcgcatataaaaagtacggc
aaacttgagcagaaggccgatcagtccttatctcaataa

DBGET integrated database retrieval system