KEGG   Bacillus subtilis subsp. subtilis 168: BSU37780
Entry
BSU37780          CDS       T00010                                 

Symbol
rocA
Name
(RefSeq) 1-pyrroline-5-carboxylate dehydrogenase
  KO
K00294  1-pyrroline-5-carboxylate dehydrogenase [EC:1.2.1.88]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00250  Alanine, aspartate and glutamate metabolism
bsu00330  Arginine and proline metabolism
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BSU37780 (rocA)
   00330 Arginine and proline metabolism
    BSU37780 (rocA)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     BSU37780 (rocA)
SSDB
Motif
Pfam: Aldedh
Other DBs
NCBI-GeneID: 937222
NCBI-ProteinID: NP_391658
Pasteur: BG10622
BSORF: BG10622
UniProt: P39634 A0A6M3ZH77
LinkDB
Position
complement(3878966..3880513)
AA seq 515 aa
MTVTYAHEPFTDFTEAKNKTAFGESLAFVNTQLGKHYPLVINGEKIETDRKIISINPANK
EEIIGYASTADQELAEKAMQAALQAFDSWKKQRPEHRANILFKAAAILRRRKHEFSSYLV
KEAGKPWKEADADTAEAIDFLEFYARQMLKLKEGAPVKSRAGEVNQYHYEALGVGIVISP
FNFPLAIMAGTAVAAIVTGNTILLKPADAAPVVAAKFVEVMEEAGLPNGVLNYIPGDGAE
IGDFLVEHPKTRFVSFTGSRAVGCRIYERAAKVQPGQKWLKRVIAEMGGKDTVLVDKDAD
LDLAASSIVYSAFGYSGQKCSAGSRAVIHQDVYDEVVEKAVALTKTLTVGNPEDPDTYMG
PVIHEASYNKVMKYIEIGKSEGKLLAGGEGDDSKGYFIQPTIFADVDENARLMQEEIFGP
VVAICKARDFDHMLEIANNTEYGLTGALLTKNRAHIERAREDFHVGNLYFNRGCTGAIVG
YQPFGGFNMSGTDSKAGGPDYLILHMQAKTTSEAF
NT seq 1548 nt   +upstreamnt  +downstreamnt
atgacagtcacatacgcgcacgaaccatttaccgattttacggaagcaaagaataaaact
gcatttggggagtcattggcctttgtaaacactcagctcggcaagcattatccgcttgtc
ataaatggagaaaaaattgaaacggaccgcaaaatcatttctattaacccggcaaataaa
gaagagatcattgggtacgcgtctacagcggatcaagagcttgctgaaaaagcgatgcaa
gccgcattgcaggcatttgattcctggaaaaaacaaagaccggagcaccgcgcaaatatt
ctctttaaggcagcggctattttgcgcagaagaaagcatgaattttcaagctatcttgtg
aaggaagcaggaaaaccgtggaaggaagcagatgcggacacggctgaagcgatagacttt
ttagagttctacgcgcgccaaatgttaaagctcaaggaaggggctccggtgaagagccgt
gctggcgaggtcaatcaatatcattacgaagcgcttggcgtcggcatcgtcatttctcca
tttaacttcccgctcgcgattatggcgggaacagcggtggcagcgattgtgacaggaaat
acgattctcttaaaaccggctgacgcagccccggtagtggcagcaaaatttgtcgaggtc
atggaggaagcgggtctgccaaacggcgttctgaattacattccgggagatggtgcggag
atcggtgatttcttagttgagcatccgaagacacggtttgtctcatttacaggttcccgt
gcagtcggctgccggatttatgagcgagctgccaaagtgcagccgggccaaaaatggctc
aaacgggtaattgcagaaatgggcggaaaagacacagtgcttgtcgacaaggacgctgat
cttgaccttgctgcatcctctatcgtgtattcagcatttggatattcaggacagaagtgt
tctgcgggctcccgcgcggtcattcatcaggatgtgtatgatgaagtggtggaaaaagct
gtggcgctgaccaaaacgctgactgtcggcaatccagaagatcctgatacgtatatgggt
cccgtgattcatgaagcatcctacaacaaagtgatgaaatacattgaaatcggcaaatct
gaaggcaagctattggccggcggagaaggcgatgattcaaaaggctactttattcagccg
acgatctttgcagatgttgatgaaaacgcccgcttgatgcaggaagaaattttcggcccg
gttgttgcgatttgcaaagcgcgtgatttcgatcatatgctggagattgccaataacacg
gaatacggattaacaggtgcgcttctgacgaaaaaccgtgcgcacattgaacgggcgcgc
gaggatttccatgtcggaaacctatattttaacagaggatgtaccggagcaattgtcggc
tatcagccgttcggcggttttaatatgtcaggaacagactcaaaagcaggcggtcccgat
tacttaattcttcatatgcaagccaaaacaacgtccgaagctttttga

DBGET integrated database retrieval system