KEGG   Bacillus subtilis subsp. subtilis 168: BSU37830Help
Entry
BSU37830          CDS       T00010                                 

Gene name
spsJ
Definition
(RefSeq) dTDP-glucose 4,6-dehydratase
  KO
K01710  dTDP-glucose 4,6-dehydratase [EC:4.2.1.46]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00521  Streptomycin biosynthesis
bsu00523  Polyketide sugar unit biosynthesis
bsu00525  Acarbose and validamycin biosynthesis
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
Module
bsu_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    BSU37830 (spsJ)
   01055 Biosynthesis of vancomycin group antibiotics
    BSU37830 (spsJ)
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BSU37830 (spsJ)
   00525 Acarbose and validamycin biosynthesis
    BSU37830 (spsJ)
Enzymes [BR:bsu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.46  dTDP-glucose 4,6-dehydratase
     BSU37830 (spsJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase 3Beta_HSD RmlD_sub_bind Polysacc_synt_2 NAD_binding_4 KR NAD_binding_10 adh_short Sacchrp_dh_NADP adh_short_C2
Motif
Other DBs
NCBI-GeneID: 937227
NCBI-ProteinID: NP_391662
Pasteur: BG10618
BSORF: BG10618
UniProt: P39630
LinkDB All DBs
Position
complement(3884292..3885239)
Genome map
AA seq 315 aa AA seqDB search
MAKSYLITGGAGFIGLTFTKLMLRETDARITVLDKLTYASHPEEMEKLKQNSRFRFVKGD
ISVQEDIDRAFDETYDGVIHFAAESHVDRSISQAEPFITTNVMGTYRLAEAVLKGKAKKL
IHISTDEVYGDLKADDPAFTETTPLSPNNPYSASKASSDLLVLSYVKTHKLPAIITRCSN
NYGPYQHSEKMIPTIIRHAKQGLPVPLYGDGLQIRDWLFAEDHCRAIKLILEKGTDGEVY
NIGGGNERTNKELASVILKHLGCEELFAHVEDRKGHDRRYAINASKLKNELGWRQEVTFE
EGIARTIQWYTDNDR
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaatcatatttaattacaggcggggccggcttcatcgggctcacgtttacaaag
ctcatgctgagggaaacggatgcgcgcattaccgttttagataaactgacgtacgccagc
cacccggaggaaatggaaaaattaaagcaaaacagccgttttcgctttgtaaaaggggac
atcagcgttcaggaggatatcgaccgcgcttttgacgagacctacgatggcgtcattcac
ttcgcagcagaatcgcatgtggacagaagcatttcccaagcggagccgtttatcaccaca
aatgtcatggggacataccgattggcggaagcggtcttgaaaggaaaagccaagaagctg
attcatatttcaacagatgaggtatacggggatttaaaagcggatgatcccgcgtttaca
gaaacgacgccgctttctcctaataacccatactcagccagcaaagcaagctctgatttg
ctcgtgttgtcttatgtgaaaacccacaagcttccggccatcattacacgatgcagcaac
aattacggaccttatcagcacagcgaaaaaatgattccgacgattatccgtcatgcgaag
cagggcctgcctgttccgctgtatggcgatggactccagatccgagactggctgtttgcg
gaggatcattgccgcgcgatcaagctgattttagaaaaagggaccgacggcgaggtgtat
aacatcggcggcggaaatgaacgcacgaataaagagctggcgagtgtcattttgaagcat
ctgggctgtgaggaattgttcgcccacgtggaagaccgaaaagggcatgaccggcgctat
gcgatcaatgcatcaaagctgaaaaacgaactgggctggcggcaggaagtgacgtttgaa
gaaggcattgcgcgtacgattcagtggtatacagacaatgaccgatga

DBGET integrated database retrieval system