KEGG   Bacillus subtilis subsp. subtilis 168: BSU39260
Entry
BSU39260          CDS       T00010                                 
Symbol
bglH
Name
(RefSeq) aryl-phospho-beta-d-glucosidase BglH
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00010  Glycolysis / Gluconeogenesis
bsu00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BSU39260 (bglH)
   00500 Starch and sucrose metabolism
    BSU39260 (bglH)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     BSU39260 (bglH)
SSDB
Motif
Pfam: Glyco_hydro_1 Cellulase
Other DBs
NCBI-GeneID: 937512
NCBI-ProteinID: NP_391805
Pasteur: BG10935
BSORF: BG10935
UniProt: P40740 A0A6M3ZHY9
LinkDB
Position
complement(4032346..4033755)
AA seq 469 aa
MSSNEKRFPEGFLWGGAVAANQVEGAYNEGGKGLSTADVSPNGIMSPFDESMTSLNLYHN
GIDFYHRYKEDIALFAEMGFKAFRTSIAWTRIFPNGDEEEPNEEGLRFYDDLFDELLKHH
IEPVVTISHYEMPLGLVKNYGGWKNRKVIEFYERYAKTVFKRYQHKVKYWMTFNEINVVL
HAPFTGGGLVFEEGENKLNAMYQAAHHQFVASALAVKAGHDIIPDSKIGCMIAATTTYPM
TSKPEDVFAAMENERKTLFFSDVQARGAYPGYMKRYLAENNIEIEMAEGDEELLKEHTVD
YIGFSYYMSMAASTDPEELAKSGGNLLGGVKNPYLKSSEWGWQIDPKGLRITLNTLYDRY
QKPLFIVENGLGAVDKVEEDGTIQDDYRINYLRDHLIEAREAIADGVELIGYTSWGPIDL
VSASTAEMKKRYGFIYVDRDNEGNGTFNRIKKKSFNWYQQVIATNGESL
NT seq 1410 nt   +upstreamnt  +downstreamnt
atgagttcaaatgaaaaacgatttccagaaggatttttatggggcggcgcagttgctgcc
aaccaagtggagggtgcttataacgagggtggtaaggggctttcgacagctgacgtatcg
ccgaacgggatcatgtctccatttgatgaatcaatgacttccttgaatctgtatcacaac
gggattgacttttatcatcgttataaagaggatatcgccttatttgcagaaatgggattt
aaggcgttccgcacatcgattgcgtggacgagaatttttccgaatggcgatgaagaggag
cccaatgaagaaggcctcagattttatgatgatctgtttgatgagctgttaaagcatcat
attgagcctgtcgtaaccatctctcattatgagatgccgctcggtttagtgaaaaattat
ggcggctggaagaatcgcaaagtcatagagttttatgaacgctatgccaaaacggttttc
aaacgctatcaacacaaagtgaagtattggatgacgtttaatgaaattaacgtagtgctc
catgcgccatttaccggaggcggtcttgtttttgaagaaggagaaaacaaattaaacgcg
atgtaccaggcggcacaccaccaatttgtggccagtgctcttgctgtcaaagcgggtcac
gacatcattcctgattcgaaaatcggctgtatgatagcggcaacgacaacctatccgatg
acttctaagccggaggatgtcttcgcggcaatggagaatgagcgcaaaacacttttcttc
tcagatgttcaggcaagaggcgcatacccgggatatatgaaacgctatctggcagaaaac
aatattgaaattgaaatggctgaaggcgatgaagagctcttgaaagaacatacggtggat
tatattggatttagctactacatgtcgatggcggcgagcacagatccggaagagcttgca
aaatcagggggcaacctgctgggcggagtcaaaaacccttacctcaaatcatcagaatgg
ggctggcagattgatccgaaaggcttgcgcatcacgctcaacaccttatacgaccgttac
cagaagccgctgttcatcgttgaaaacggccttggcgctgtagacaaggttgaagaggac
ggcacgattcaggacgattacagaatcaactatctgcgtgatcatttaattgaagcgcgc
gaagccattgcggacggcgttgaattaatcggatacacatcatgggggccaattgacctt
gtcagcgcatctactgcggaaatgaaaaagcgctacggcttcatttatgtagaccgggac
aatgaaggaaatggaacatttaaccgcatcaagaaaaaaagcttcaactggtatcagcag
gttatcgccacaaacggagagagtctctga

DBGET integrated database retrieval system