KEGG   Bacillus subtilis subsp. subtilis 168: BSU39370
Entry
BSU39370          CDS       T00010                                 
Symbol
hutI
Name
(RefSeq) imidazolonepropionase
  KO
K01468  imidazolonepropionase [EC:3.5.2.7]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00340  Histidine metabolism
bsu01100  Metabolic pathways
Module
bsu_M00045  Histidine degradation, histidine => N-formiminoglutamate => glutamate
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    BSU39370 (hutI)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.2  In cyclic amides
    3.5.2.7  imidazolonepropionase
     BSU39370 (hutI)
SSDB
Motif
Pfam: Amidohydro_3 Amidohydro_1
Other DBs
NCBI-GeneID: 937531
NCBI-ProteinID: NP_391816
Pasteur: BG11100
UniProt: P42084 A0A6M4JQT4
Structure
LinkDB
Position
4045245..4046510
AA seq 421 aa
MPKQIDTILINIGQLLTMESSGPRAGKSMQDLHVIEDAVVGIHEQKIVFAGQKGAEAGYE
ADEIIDCSGRLVTPGLVDPHTHLVFGGSREKEMNLKLQGISYLDILAQGGGILSTVKDTR
AASEEELLQKAHFHLQRMLSYGTTTAEVKSGYGLEKETELKQLRVAKKLHESQPVDLVST
FMGAHAIPPEYQNDPDDFLDQMLSLLPEIKEQELASFADIFTETGVFTVSQSRRYLQKAA
EAGFGLKIHADEIDPLGGAELAGKLKAVSADHLVGTSDEGIKKLAEAGTIAVLLPGTTFY
LGKSTYARARAMIDEGVCVSLATDFNPGSSPTENIQLIMSIAALHLKMTAEEIWHAVTVN
AAYAIGKGEEAGQLKAGRSADLVIWQAPNYMYIPYHYGVNHVHQVMKNGTIVVNREGAIL
G
NT seq 1266 nt   +upstreamnt  +downstreamnt
atgccaaagcaaattgatacgattctcatcaacatcggtcagcttttgacgatggaaagc
agcggtccgcgggcaggcaaaagcatgcaggatcttcatgtgatcgaagacgctgttgtc
ggcatccatgaacagaaaattgtgttcgccggacaaaaaggggctgaagccggttacgag
gcagacgaaatcattgactgttcgggacgccttgtaacgcctggcctcgttgatccgcac
acccatcttgtatttggcggatctcgtgaaaaggagatgaaccttaagcttcagggcatt
tcatatttggatattctggcgcagggcggcgggattctgtctacagtcaaggataccagg
gcggcttcagaagaagagctgctgcaaaaagcccattttcatctgcaaagaatgctgtcc
tacggcacaaccacagcagaagtgaaaagcggctacggcttggaaaaagagacagagctc
aaacagttgcgtgtcgcaaagaaactgcatgaaagccagcctgttgaccttgtttccaca
tttatgggagcccatgcgattcctcccgaatatcaaaacgatccagatgattttctggat
caaatgctttcccttttgccggaaatcaaagagcaggagctcgccagctttgctgatatt
tttacagaaacaggcgtttttacagtcagccaatcccgccgttatttacaaaaagcagct
gaggcaggcttcggattaaaaatacacgcagatgaaatcgatccgcttggaggtgctgaa
ttagcaggtaagctaaaggccgtctcagccgaccatttggtaggtacatcggacgaaggc
ataaagaaattggctgaggcaggaacgatcgccgtcctcttgccgggcacgacattttat
cttggcaaaagcacatacgccagggcaagagctatgattgatgaaggtgtatgtgtcagc
ttggcaacggattttaatcctggcagctcgccgactgaaaatatccagctgattatgtcc
attgccgcgcttcatctgaaaatgactgcagaagaaatatggcacgcggtcacagtcaat
gccgcatatgccataggaaaaggagaagaagccggtcagctcaaagctggccgctcagct
gatcttgtcatttggcaagccccgaactatatgtatattccgtatcactacggggtcaat
catgtacatcaagtcatgaaaaatggaacaattgttgtcaacagggagggagccattctt
ggataa

DBGET integrated database retrieval system