KEGG   Bacillus subtilis subsp. subtilis 168: BSU39730
Entry
BSU39730          CDS       T00010                                 

Symbol
iolD
Name
(RefSeq) 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione acylhydrolase (decyclizing)
  KO
K03336  3D-(3,5/4)-trihydroxycyclohexane-1,2-dione acylhydrolase (decyclizing) [EC:3.7.1.22]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00562  Inositol phosphate metabolism
bsu01100  Metabolic pathways
bsu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    BSU39730 (iolD)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.22  3D-(3,5/4)-trihydroxycyclohexane-1,2-dione acylhydrolase (ring-opening)
     BSU39730 (iolD)
SSDB
Motif
Pfam: TPP_enzyme_C TPP_enzyme_M TPP_enzyme_N CO_dh
Other DBs
NCBI-GeneID: 937590
NCBI-ProteinID: NP_391852
Pasteur: BG11120
BSORF: BG11120
UniProt: P42415 A0A6M3ZID5
LinkDB
Position
complement(4079083..4080996)
AA seq 637 aa
MGKKIRLTTAQALIKFLNQQYIHVDGKEEPFVEGIFTIFGHGNVLGIGQALEQDAGHLKV
YQGKNEQGMAHAAMAYSKQMLRRKIYAVSTSVGPGAANLVAAAGTALANNIPVLLIPADT
FATRQPDPVLQQMEQEYSAAITTNDALKPVSRYWDRITRPEQLMSSLLRAFEVMTDPAKA
GPATICISQDVEGEAYDFDESFFVKRVHYIDRMQPSERELQGAAELIKSSKKPVILVGGG
AKYSGARDELVAISEAYNIPLVETQAGKSTVEADFANNLGGMGITGTLAANKAARQADLI
IGIGTRYTDFATSSKTAFDFDKAKFLNINVSRMQAYKLDAFQVVADAKVTLGKLHGLLEG
YESEFGTTIRELKDEWLAERERLSKVTFKREAFDPEIKNHFSQEVLNEYADALNTELPQT
TALLTINETIPEDSVIICSAGSLPGDLQRLWHSNVPNTYHLEYGYSCMGYEVSGTLGLKL
AHPDREVYSIVGDGSFLMLHSELITAIQYNKKINVLLFDNSGFGCINNLQMDHGSGSYYC
EFRTDDNQILNVDYAKVAEGYGAKTYRANTVEELKAALEDAKKQDVSTLIEMKVLPKTMT
DGYDSWWHVGVAEVSEQESVQKAYEAKEKKLESAKQY
NT seq 1914 nt   +upstreamnt  +downstreamnt
gtgggtaagaaaattcgcttaacaactgcgcaggcgctgattaaattcttaaaccagcag
tacatccatgtagatggaaaggaagagccttttgtcgaagggatcttcacgattttcggt
catggaaacgtattagggatcgggcaggcgcttgagcaggatgcaggccatttgaaagtc
tatcaagggaaaaatgaacaaggaatggcgcatgcggccatggcgtacagcaagcaaatg
ctgagaagaaaaatatatgcggtgtctacatccgtcggacctggagcggctaacttggtg
gcggcagccggcactgcattggcaaataatatcccagttctcttgattccggcagacaca
tttgcgacaagacagccagaccctgtactgcagcaaatggagcaagaatacagtgcggcg
attacgacaaacgatgcattgaagcctgtatcgagatactgggaccgcattacgcgccct
gagcagctgatgagcagtttgctgcgcgcgtttgaagtcatgactgatccggcaaaagca
ggtccggcaacgatttgtatttctcaggatgttgaaggggaagcatacgattttgatgaa
agtttcttcgtcaaacgggttcactatattgatcgcatgcagccgagcgagcgcgagctt
caaggtgcggcggagctgattaaatccagcaaaaaacctgtgattctcgtcggcggaggc
gcaaaatattccggtgcgcgcgatgaattggttgccatttctgaagcctataacattccg
ttagttgaaacgcaggcaggaaagtctaccgttgaggcagattttgcgaacaaccttggc
ggaatgggcatcacaggtacacttgcggcaaacaaagcggcccgccaagctgatttgatt
atcggcatcggcacaaggtatacagattttgcgacatcctctaagaccgcttttgatttt
gataaagcgaagtttttgaacattaacgtcagccgaatgcaggcgtataaacttgatgca
ttccaagtggtggcggatgcgaaagtgacgcttggcaaactgcacggcttgcttgaaggc
tatgagagcgagttcggcacaacgatccgggagctgaaggacgaatggctagctgaacgc
gagcgtctcagcaaagtgacgtttaagcgggaagcatttgatccggaaatcaaaaatcac
ttttctcaagaggtcctgaatgaatatgctgacgcgttgaatacggagcttccgcaaaca
acggcattgctgacaatcaacgagacgattcctgaagacagcgtcatcatctgttcagca
ggctcactcccaggagatttgcagcgtctgtggcattctaatgttccgaatacgtatcac
ctggagtatggatattcttgcatgggctatgaagtgtccgggacactcggtcttaaactg
gcccaccctgacagagaagtgtattcaatcgtcggagacggcagcttcctgatgcttcat
tctgaactgatcacggcgattcagtacaacaagaaaatcaatgtgctgctctttgacaac
tcaggattcggatgcatcaacaacctgcaaatggatcacggcagcggcagctactattgc
gagttccgcacagatgacaaccaaatcctgaatgtcgattacgcgaaagtcgctgaggga
tacggcgcgaaaacctaccgtgcaaacacagtagaagaattaaaagctgcgttagaggat
gcgaagaaacaggatgtatcaacattaattgaaatgaaggtgctgcctaaaacaatgacg
gacggctatgacagctggtggcatgtcggggtggcagaggtatctgaacaagaaagcgtt
cagaaagcatacgaagcaaaagagaaaaagctggaatctgcgaagcagtattag

DBGET integrated database retrieval system