KEGG   Bacillus subtilis subsp. subtilis 168: BSU39860
Entry
BSU39860          CDS       T00010                                 

Symbol
aldX
Name
(RefSeq) aldehyde dehydrogenase AldX
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00010  Glycolysis / Gluconeogenesis
bsu00053  Ascorbate and aldarate metabolism
bsu00071  Fatty acid degradation
bsu00280  Valine, leucine and isoleucine degradation
bsu00310  Lysine degradation
bsu00330  Arginine and proline metabolism
bsu00340  Histidine metabolism
bsu00380  Tryptophan metabolism
bsu00410  beta-Alanine metabolism
bsu00561  Glycerolipid metabolism
bsu00620  Pyruvate metabolism
bsu00625  Chloroalkane and chloroalkene degradation
bsu00770  Pantothenate and CoA biosynthesis
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01120  Microbial metabolism in diverse environments
bsu01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BSU39860 (aldX)
   00053 Ascorbate and aldarate metabolism
    BSU39860 (aldX)
   00620 Pyruvate metabolism
    BSU39860 (aldX)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BSU39860 (aldX)
   00561 Glycerolipid metabolism
    BSU39860 (aldX)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BSU39860 (aldX)
   00310 Lysine degradation
    BSU39860 (aldX)
   00330 Arginine and proline metabolism
    BSU39860 (aldX)
   00340 Histidine metabolism
    BSU39860 (aldX)
   00380 Tryptophan metabolism
    BSU39860 (aldX)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BSU39860 (aldX)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    BSU39860 (aldX)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BSU39860 (aldX)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BSU39860 (aldX)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     BSU39860 (aldX)
SSDB
Motif
Pfam: Aldedh LuxC HXXSHH
Other DBs
NCBI-GeneID: 937653
NCBI-ProteinID: NP_391865
Pasteur: BG11355
BSORF: BG11355
UniProt: P46329 A0A6M3ZHS5
LinkDB
Position
4093980..4095317
AA seq 445 aa
MEQQVKDDIQRVFQLQKKQQKALRASTAEQRREKLQRFLDSVIAHEEEIIEAIRKDVRKP
YHEVKKAEIEGTKKAIRDNMNNLEQWMAPKEVGSSLSPDANGILMYEPKGVTLILGPWNY
PFMLTMAPLAASLAAGNSAIVKLSDFTMNTSNIAAKVIRDAFDEKEVAIFEGEVEVATEL
LDQPFDHIFFTGSTNVGKIVMTAAAKHLASVTLELGGKSPTIIDSEYDLMDAAKKIAVGK
FVNAGQTCIAPDYLFIKKDVQDRFAGILQTVVNAGFMEDDHTPDRSKFTQIVNDRNFNRV
KDLFDDAIERGAEVVFGGVFDASDRTISPTVLKNVTPDMKIMQEEIFASILPMMNYEDID
EVIDYVNDRDKPLALYVFSKNQDLIDNVLQHTTSGNAAINDVVVHFSDVNLPFGGVNTSG
IGSYHGVYGFKEFSHEKGVFIQAAE
NT seq 1338 nt   +upstreamnt  +downstreamnt
atggaacagcaagtaaaggacgacatccagcgtgtctttcagcttcagaaaaaacagcaa
aaagccttgcgcgcttcaacagcggaacagcggagagaaaagcttcaacgctttttagat
tccgtcatcgcccatgaagaagaaatcatcgaagcgatccgcaaagacgtccgcaaacca
tatcacgaagtcaaaaaagcggaaatcgaaggaacaaaaaaagcgattagagataatatg
aataacctggaacaatggatggcgcctaaagaagtcggttcatcgttaagccctgacgca
aacggaattcttatgtacgagcctaaaggcgtcacactcatcctcggcccgtggaactat
ccgtttatgctgacgatggcgccgcttgccgcttctctcgcagccggaaacagcgcgatt
gtgaagctgtccgatttcacgatgaacacgagcaacattgctgctaaagtaataagagac
gcttttgatgaaaaagaagtcgcgatttttgaaggagaggttgaggtggcaaccgaacta
cttgatcagccgttcgaccatattttcttcactggaagcacaaatgtcgggaaaattgtc
atgacagcggctgccaaacacttggcatctgtcacacttgagcttggcggcaagagcccg
acgatcattgacagtgaatacgatctgatggacgcagcgaaaaagatcgccgtcgggaaa
ttcgtaaacgccggccaaacctgcatcgcacctgattacctgttcattaaaaaagacgtt
caggacaggttcgcggggattttacaaacagtcgtcaacgctggatttatggaggatgat
cataccccagaccgcagcaaatttacgcagatcgtcaatgaccgcaacttcaaccgcgtc
aaagatctgttcgacgatgccatcgaaagaggggcggaagtggtgttcggcggcgtattc
gatgccagcgaccgcacgatctcgccaaccgttttgaaaaacgtcacgcctgacatgaaa
atcatgcaggaggaaatcttcgcatcgatcctgccaatgatgaactatgaagacatcgac
gaggtcatcgattacgtaaatgaccgcgataaaccgcttgcactttatgtgttcagcaaa
aaccaagatctgattgacaacgtccttcagcacacgacatcaggaaatgccgccatcaat
gatgtcgtcgtccatttcagtgacgtcaacctgccattcggcggcgtcaacacaagcgga
atcggctcctatcatggggtatacggattcaaagagttttctcatgagaagggtgtattt
attcaggccgctgaataa

DBGET integrated database retrieval system