KEGG   Bacillus subtilis subsp. subtilis 168: BSU39960
Entry
BSU39960          CDS       T00010                                 
Symbol
yxaI
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: RDD
Other DBs
NCBI-GeneID: 937676
NCBI-ProteinID: NP_391876
Pasteur: BG11111
BSORF: BG11111
UniProt: P42108 A0A6M4JQV5
LinkDB
Position
4104444..4104899
AA seq 151 aa
MEKPAGFWIRFLAYFIDGIIVSVPSYIILFIINSVFVAGAVATNPYMTEEEYLVKYMTLA
FLPTMLIMIVISVLYYGLLTASKMQGTLGKKILGLKVVNEQGERVSVGQGIGRYFAYILS
GIIFYIGFIMIAFGEKKGLHDIICKTRVVYK
NT seq 456 nt   +upstreamnt  +downstreamnt
atggaaaaaccagcaggattttggattcgttttttagcttattttattgacggcattatt
gtatctgttcctagttatattattctatttattatcaattctgtgtttgtagctggggct
gtggcaacaaacccttacatgacggaagaagagtatttagtgaaatacatgacgcttgca
tttttgcctactatgctgatcatgatcgtcatcagcgtgttatattacgggctgctcaca
gcttctaaaatgcaaggcacacttggcaaaaaaattcttggcctgaaagtggtcaatgaa
caaggtgaacgggtttctgtcggacagggaattggccgttactttgcctatatcttatct
ggaatcatcttttatatcgggtttatcatgatcgcctttggagagaaaaaaggcctgcat
gacatcatttgcaaaacacgtgtcgtgtataaataa

DBGET integrated database retrieval system