KEGG   Bacillus subtilis subsp. subtilis 168: BSU40130
Entry
BSU40130          CDS       T00010                                 
Symbol
yydK
Name
(RefSeq) HTH-type transcriptional regulator YydK
  KO
K03489  GntR family transcriptional regulator, transcriptional regulator of bglA
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU40130 (yydK)
Transcription factors [BR:bsu03000]
 Prokaryotic type
  Helix-turn-helix
   GntR family
    BSU40130 (yydK)
SSDB
Motif
Pfam: UTRA GntR HTH_11 HTH_41 HTH_DeoR HTH_36 MarR_2 Fe_dep_repress TrmB
Other DBs
NCBI-GeneID: 937726
NCBI-ProteinID: NP_391893
Pasteur: BG11484
BSORF: BG11484
UniProt: Q45591 A0A6M3ZI33
Structure
LinkDB
Position
4123193..4123903
AA seq 236 aa
MLKYQQIATEIETYIEEHQLQQGDKLPVLETLMAQFEVSKSTITKSLELLEQKGAIFQVR
GSGIFVRKHKRKGYISLLSNQGFKKDLEDFNVTSKVIELDVRKPTPEAAENLNIGMDEDI
YYVKRVRYINGQTLCYEESYYTKSIVTYLNNEIVSHSIFHYIREGLGLKIGFSDLFLHVG
QLNEEEAEYLGLEAGLPKLYIESIFHLTNGQPFDYSKISYNYEQSQFVVQANSFLL
NT seq 711 nt   +upstreamnt  +downstreamnt
atgttaaaataccagcaaatcgcaacggaaattgaaacatatatagaagaacaccagctt
cagcagggagacaaactgccagtcctagaaaccctcatggcccagtttgaagtcagcaaa
agcaccatcacaaagtccctcgagctattagagcaaaaaggcgcgatctttcaggtcaga
ggaagcggcattttcgtcagaaaacataaacgaaaaggctatatcagccttctgtcgaat
cagggatttaaaaaagatctcgaggatttcaacgtcacctcaaaagtcatcgaactggac
gtgagaaagccaacaccggaagcggcggaaaacctgaacatcggaatggacgaggacatc
tactatgtcaaaagggtccgctacatcaacggccagaccctttgctacgaagaatcctat
tacaccaaatccatcgtgacgtatttaaacaacgaaatcgtctcccactccatcttccat
tacatccgggaaggactggggttgaagattggtttttctgatttgtttctgcacgtgggc
cagcttaatgaggaagaagcggaatatttgggattagaggctggactgccgaagctgtat
atagaaagtatttttcacctgacaaatgggcagccgtttgattactcgaagatttcgtat
aattatgagcagtcgcagtttgtggtacaggctaatagttttttattatag

DBGET integrated database retrieval system