KEGG   Bacillus subtilis subsp. subtilis 168: BSU40320
Entry
BSU40320          CDS       T00010                                 
Symbol
argI
Name
(RefSeq) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00220  Arginine biosynthesis
bsu00330  Arginine and proline metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    BSU40320 (argI)
   00330 Arginine and proline metabolism
    BSU40320 (argI)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     BSU40320 (argI)
SSDB
Motif
Pfam: Arginase SHOCT
Other DBs
NCBI-GeneID: 937760
NCBI-ProteinID: NP_391912
Pasteur: BG10932
UniProt: P39138 A0A6M4JR10
Structure
LinkDB
Position
complement(4141711..4142601)
AA seq 296 aa
MDKTISVIGMPMDLGQARRGVDMGPSAIRYAHLIERLSDMGYTVEDLGDIPINREKIKND
EELKNLNSVLAGNEKLAQKVNKVIEEKKFPLVLGGDHSIAIGTLAGTAKHYDNLGVIWYD
AHGDLNTLETSPSGNIHGMPLAVSLGIGHESLVNLEGYAPKIKPENVVIIGARSLDEGER
KYIKESGMKVYTMHEIDRLGMTKVIEETLDYLSACDGVHLSLDLDGLDPNDAPGVGTPVV
GGISYRESHLAMEMLYDAGIITSAEFVEVNPILDHKNKTGKTAVELVESLLGKKLL
NT seq 891 nt   +upstreamnt  +downstreamnt
atggataaaacgatttcggttattggaatgccaatggatttaggacaagcacgacgcgga
gtggatatgggcccgagtgccatccggtacgctcatctgatcgagaggctgtcagacatg
gggtatacggttgaagatctcggtgacattccgatcaatcgcgaaaaaatcaaaaatgac
gaggaactgaaaaacctgaattccgttttggcgggaaatgaaaaactcgcgcaaaaggtc
aacaaagtcattgaagagaaaaaattcccgcttgtcctgggcggtgaccacagtattgcg
atcggcacgcttgcaggcacagcgaagcattacgataatctcggcgtcatctggtatgac
gcgcacggcgatttgaatacacttgaaacttcaccatcgggcaatattcacggcatgccg
ctcgcggtcagcctaggcattggccacgagtcactggttaaccttgaaggctacgcgcct
aaaatcaaaccggaaaacgtcgtcatcattggcgcccggtcacttgatgaaggggagcgc
aagtacattaaggaaagcggcatgaaggtgtacacaatgcacgaaatcgatcgtcttggc
atgacaaaggtcattgaagaaacccttgattatttatcagcatgtgatggcgtccatctg
agccttgatctggacggacttgatccgaacgacgcaccgggtgtcggaacccctgtcgtc
ggcggcatcagctaccgggagagccatttggctatggaaatgctgtatgacgcaggcatc
attacctcagccgaattcgttgaggttaacccgatccttgatcacaaaaacaaaacgggc
aaaacagcagtagagctcgtagaatccctgttagggaagaagctgctgtaa

DBGET integrated database retrieval system