KEGG   Bacillus subtilis subsp. subtilis 168: BSU40390
Entry
BSU40390          CDS       T00010                                 
Symbol
walH
Name
(RefSeq) two-component system YycF/YycG regulatory protein YycH
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: YycH
Other DBs
NCBI-GeneID: 937790
NCBI-ProteinID: NP_391919
Pasteur: BG11462
UniProt: Q794W0
Structure
LinkDB
Position
complement(4150496..4151863)
AA seq 455 aa
MKRENIKTILLTVLVVISLVFTWGIWTFQPNFSEGSSSTESTVRVKHKIEKTTQKLSETV
RPRDMFIHDDGAHYKVDDNALYEEIWSDLPHWDVKGIKDISDQYDKAGFKSWFYGIGGSE
AKLDLQFSDTIPIDIFQTLFKWSNQSFEYSSFDHILIPFNETKANKKIYLVSYSKQLILE
VTVESANYRNIMNDLKNRQSNMPAFSLFSIGSKKEFLLPNKPLTMDKKEFVTESIKTNTF
KQALFSDPSIVREDSNYNNRNVLTDGISRLDVNLSQRQVQFQQRNLVQSTSYQTGELIKK
SQKYLEDTGSWTDHYQFFNINDSQQLSFYIFMDQIPVINSTAKPFGATSAITVQWANDDI
LSYKRPNYSLGTNPIKTSETELMGGSEVKMLLSKQTAYDTDKIDQIFLAYQLVSTSTNDD
PLVELEPVWAMKVNGKIVPITKDLLRKEGANSGVE
NT seq 1368 nt   +upstreamnt  +downstreamnt
atgaagcgtgaaaatataaaaacgatattacttacggtactcgtcgtcatcagtcttgtt
tttacatgggggatatggacgttccagccaaacttttctgaaggctcatcctcaacagag
tctactgttcgtgtgaaacataaaatcgaaaaaaccacccaaaagctgtctgaaacggta
aggccaagggacatgtttatccatgatgacggcgctcattacaaagtggatgacaatgcc
ctctatgaagaaatttggtctgacttgccgcattgggatgtgaaaggaattaaagatatt
tcggatcagtatgacaaggctggattcaaaagctggttttatggaataggcggttctgaa
gccaagcttgacttgcaattcagcgatacgatcccgattgatattttccaaacgctgttt
aaatggtctaatcagtcgtttgaatacagttcgtttgaccatattctgatcccgttcaat
gaaacaaaagcgaacaagaaaatctatttggtgtcatacagcaagcagctcattcttgaa
gtgacggttgaatcagcaaactaccggaacattatgaacgacttgaaaaacaggcaatca
aatatgccggcgttcagtttgttctccattggctcaaagaaagagttcttgctgccgaac
aaaccgcttacgatggacaaaaaagaatttgtcacagaatcgattaaaacaaataccttt
aagcaggctttgtttagtgatccgagcattgtaagagaagattcgaattacaacaacaga
aatgtgctgacagatgggatcagccggttagatgtgaatctaagccagagacaggtgcaa
tttcagcagcgcaatttggtgcagagcacatcctatcaaacaggtgaattaatcaaaaag
agccaaaaataccttgaggataccggaagctggacggatcactatcaatttttcaatatc
aatgacagccagcagttgagcttctatatttttatggatcagatcccggtcattaacagc
accgccaaacctttcggggcgacatcggcgattacggtgcaatgggcgaatgatgatatt
ctcagctataagcggccgaattacagtctcggaacgaatccgattaaaacaagtgaaaca
gagctcatgggcggcagcgaagtgaagatgctgctttcgaaacaaaccgcttatgatacg
gacaaaattgatcagatcttccttgcttatcaattggtatcaacatcaaccaacgatgat
cctctcgttgaactggaaccggtttgggcgatgaaagtaaatggaaaaattgtgccgatt
acaaaggatttattgaggaaggagggggctaacagtggagtggaataa

DBGET integrated database retrieval system