KEGG   Bacillus subtilis subsp. subtilis 168: BSU40400
Entry
BSU40400          CDS       T00010                                 

Gene name
walK
Definition
(RefSeq) sensor histidine kinase
  KO
K07652  two-component system, OmpR family, sensor histidine kinase VicK [EC:2.7.13.3]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU40400 (walK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bsu01001]
    BSU40400 (walK)
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:bsu02022]
    BSU40400 (walK)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     BSU40400 (walK)
Protein kinases [BR:bsu01001]
 Histidine kinases
  OmpR family
   BSU40400 (walK)
Two-component system [BR:bsu02022]
 OmpR family
  VicK-VicR (cell wall metabolism)
   BSU40400 (walK)
SSDB
Motif
Pfam: HATPase_c HisKA HAMP PAS_9 dCache_1 PAS HATPase_c_3 dCache_3 PAS_4 PAS_7 PAS_8 MetOD1
Other DBs
NCBI-GeneID: 937793
NCBI-ProteinID: NP_391920
Pasteur: BG11461
BSORF: BG11461
UniProt: Q45614 A0A6M4JR07
LinkDB
Structure
PDB: 
3SL2

Position
complement(4151853..4153688)
AA seq 611 aa
MNKVGFFRSIQFKITLIYVLLIIIAMQIIGVYFVNQVEKSLISSYEQSLNQRIDNLSYYI
EQEYKSDNDSTVIKDDVSRILNDFTKSDEVREISFVDKSYEVVGSSKPYGEEVAGKQTTD
LIFKRIFSTKQSYLRKYYDPKSKIRVLISAKPVMTENQEVVGAIYVVASMEDVFNQMKTI
NTILASGTGLALVLTALLGIFLARTITHPLSDMRKQAMELAKGNFSRKVKKYGHDEIGQL
ATTFNHLTRELEDAQAMTEGERRKLASVIAYMTDGVIATNRNGAIILLNSPALELLNVSR
ETALEMPITSLLGLQENYTFEDLVEQQDSMLLEIERDDELTVLRVNFSVIQREHGKIDGL
IAVIYDVTEQEKMDQERREFVANVSHELRTPLTTMRSYLEALAEGAWENKDIAPRFLMVT
QNETERMIRLVNDLLQLSKFDSKDYQFNREWIQIVRFMSLIIDRFEMTKEQHVEFIRNLP
DRDLYVEIDQDKITQVLDNIISNALKYSPEGGHVTFSIDVNEEEELLYISVKDEGIGIPK
KDVEKVFDRFYRVDKARTRKLGGTGLGLAIAKEMVQAHGGDIWADSIEGKGTTITFTLPY
KEEQEDDWDEA
NT seq 1836 nt   +upstreamnt  +downstreamnt
atgaataaggttggtttttttcggtcgatccaatttaagattaccttgatttatgtgctt
ttgattatcattgccatgcaaatcattggtgtgtattttgtcaatcaggtagagaagtcg
ctgatcagctcttatgaacaatcgctgaatcagcgaatcgacaacctttcttattatatc
gaacaagaatataagagcgataacgacagtaccgtcataaaggatgacgtcagccgtatt
ttgaatgacttcacgaaaagtgatgaggttcgggaaattagctttgtagataaaagctat
gaagtggtcggttcttcaaagccgtacggtgaggaagtggctgggaaacaaacgaccgat
ctgattttcaaaagaatcttttctaccaaacagtcgtatttaagaaaatattatgacccg
aaaagcaaaatcagagttcttatttccgcgaagcccgtcatgactgaaaaccaagaggtt
gtgggcgcgatctacgttgtcgcgagtatggaagatgtctttaatcaaatgaagacgatc
aacacgatactggcgtccggcacaggtttggcacttgttttgacggctcttctcggtatt
tttctggcaagaaccattacccacccgctttcagatatgcgaaagcaggcgatggagctt
gcgaaagggaatttctcgaggaaggttaaaaagtatggacatgatgaaattgggcagctg
gccacaacgtttaaccacttaacgagagagcttgaagatgcccaggcgatgactgaagga
gaacgcagaaagctagcctctgtcattgcttatatgacagacggcgttatcgccacaaac
cgaaacggagcgattattctcttaaacagcccggcgctggaactgttgaacgtttcacgt
gaaacagccttagaaatgccgattacgagtttgctggggcttcaagagaattatactttt
gaagatttagtggaacagcaggattctatgctgcttgaaattgagcgcgatgatgaatta
acggtgcttcgcgtgaatttctctgtgattcaaagggaacacggcaaaattgatggttta
atcgctgtcatttacgatgtaaccgaacaagagaaaatggatcaggaacgcagagaattc
gttgcgaatgtatcacatgagctgcggacgccgcttacgacaatgcgcagctatttagaa
gcgttagctgaaggcgcgtgggaaaataaagacattgctccgcgcttcttaatggtgacg
caaaatgaaacagagcgtatgatccggcttgtcaatgatctgcttcagctgtcgaaattt
gacagtaaagattatcaatttaaccgggaatggattcagattgtccggtttatgtcactt
attattgaccgttttgaaatgacaaaagagcagcatgtggagtttatccgcaatctgccg
gacagagatctgtatgtcgagattgaccaggataaaataacgcaggtgctcgataatatt
atttctaacgctttaaaatattcaccggaaggcggacatgtcacgttctcgattgatgtc
aatgaagaggaagaacttctctatatcagcgtgaaggatgaagggatcggcattccgaaa
aaagatgtcgaaaaagtctttgaccgcttctacagggtggataaagcgagaacgagaaag
cttggcggcaccggtctgggattggcgattgccaaggaaatggtacaggcgcacggtgga
gatatttgggcggacagcatagaaggaaaaggcacgacgattacatttactcttccatat
aaagaggaacaagaggatgattgggatgaagcgtga

DBGET integrated database retrieval system