KEGG   Bacillus subtilis subsp. subtilis 168: BSU40430
Entry
BSU40430          CDS       T00010                                 
Symbol
yycE
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Glyoxalase
Other DBs
NCBI-GeneID: 937806
NCBI-ProteinID: NP_391923
Pasteur: BG10003
UniProt: P37479 A0A6M4JR17
Structure
LinkDB
Position
complement(4156931..4157350)
AA seq 139 aa
MGKRFSSFQAAQIRIARPTGQLDEIIRFYEEGLCLKRIGEFSQHNGYDGVMFGLPHADYH
LEFTQYEGGSTAPVPHPDSLLVFYVPNAVELAAITSKLKHMGYQEVESENPYWSNGGVTI
EDPDGWRIVFMNSKGISGK
NT seq 420 nt   +upstreamnt  +downstreamnt
atgggaaaacgtttttcgtcttttcaagcagcacaaatccgaattgcgcgtcctacgggc
cagcttgatgagattattcgtttttacgaagagggactgtgtttgaaacgaataggagaa
ttttcacagcataacgggtatgacggtgtcatgttcggccttcctcatgccgattatcat
ttggaattcacccagtatgaagggggaagcactgcccccgttccccatcccgacagcctt
cttgttttttatgtgccgaatgcagttgaactggcagcgatcacttcaaagctaaagcac
atgggctatcaagaggtcgaatcagagaacccgtactggagcaatgggggcgtgacgata
gaggacccggacggctggcggatcgtttttatgaattcaaaagggatatcaggcaagtga

DBGET integrated database retrieval system