KEGG   Bacillus subtilis subsp. subtilis 168: BSU40590
Entry
BSU40590          CDS       T00010                                 
Symbol
yybM
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF2705 TMEM132D_C
Other DBs
NCBI-GeneID: 937824
NCBI-ProteinID: NP_391939
Pasteur: BG10018
UniProt: P37491 A0A6M3ZI81
LinkDB
Position
4173665..4174420
AA seq 251 aa
MESHIYRIIKNKLTIIIFTIIILIPCVDISLLLMTNTEYHPAYAFFLSGTSVGHASQMIL
LWFLPLYFLLLCADDSIQDYKTGYHYILISKVGRKKYCLEKIFTSFIISFLTMFLSLILN
FLLVQVFFFKGTFKNDLDQIKFPDNSLYTFSMAHPYIAIVLFSIICCIMSGFVGALGSSL
SLLFRDKKYAYPASFFIWFVLILKNKSLMFLFQPFTEYGYNVLLPILCLSIFIFLIIISS
IVLYEAKYNEN
NT seq 756 nt   +upstreamnt  +downstreamnt
atggaaagtcatatttatcgcattatcaaaaataaattaactataataatatttactata
atcatattaattccttgtgttgatatatcactattgttaatgactaacacagaataccat
cctgcatatgcgtttttcctttctggcacttccgtagggcatgcttcacaaatgatccta
ttatggtttcttccgctttattttttgttactatgtgctgacgattctatacaagattat
aaaacaggatatcattacattcttataagcaaagttggcagaaaaaaatattgtttggaa
aaaatatttacctcttttatcatttcatttttgacaatgtttttgtcactaatattaaac
tttttattggttcaggttttcttttttaaaggtacatttaaaaatgacttagaccaaatt
aaattccctgataacagcctttatacttttagtatggcccatccttatatagcaattgtg
ttattttctattatttgttgtattatgtctggatttgttggagcacttggttcaagcctc
agtttactttttcgtgataagaagtatgcctacccagcaagtttttttatttggttcgta
cttatactaaaaaacaaatcattaatgtttttattccaaccgtttacagaatacggttat
aatgtacttctccctatcctatgtttgtctatctttatttttctaataataatttctagt
attgttttatatgaggcaaaatacaatgaaaattaa

DBGET integrated database retrieval system