KEGG   Bacillus subtilis subsp. subtilis 168: BSU40760Help
Entry
BSU40760          CDS       T00010                                 

Gene name
yyaP
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RibD_C
Motif
Other DBs
NCBI-GeneID: 937903
NCBI-ProteinID: NP_391956
Pasteur: BG10035
BSORF: BG10035
UniProt: P37508
LinkDB All DBs
Structure
PDB: 

Position
4186608..4187174
Genome map
AA seq 188 aa AA seqDB search
MTNNLKQRRIILDLAVTLDGFIEGKNGEVDWCIMDPDMGFTDFLNQIDTILYGRKSFDLW
GQYIPKNEDPDTEKELWKLVHSKKKYVFSRTQNEIDNQAIFINDNILEEVNKLKKNPGKD
IWLYGGASLITTFINLGLVDEFRLSIHPVVLGEGKPLFIDVKQRINLKMVNTRTFSSGVV
QIVYHWNG
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgacaaataacttaaaacagagaagaatcattttagatttagcagttactttagatggt
tttattgaagggaaaaatggagaagttgattggtgtattatggaccctgatatggggttt
actgattttttaaatcaaattgatactattttatatggtagaaaaagcttcgatttatgg
ggacaatacattccaaaaaatgaagaccctgatacagaaaaggaactttggaaattggtt
catagtaaaaagaaatatgttttttccagaacacaaaatgagattgataatcaagccata
tttataaatgataatattcttgaagaagtaaataaattgaagaaaaatcctggtaaagac
atctggctatatggtggagcgagtctcattacaacttttataaatttggggcttgttgat
gaatttagattatctattcaccctgttgttttgggagaaggaaaaccgttgtttattgat
gtaaaacagaggataaatttaaaaatggtgaatacaagaacattttcctctggcgttgtg
caaatcgtttatcattggaatggctaa

DBGET integrated database retrieval system