KEGG   Bacillus subtilis subsp. subtilis 168: BSU40820Help
Entry
BSU40820          CDS       T00010                                 

Gene name
yyaL
Definition
(RefSeq) hypothetical protein
  KO
K06888  uncharacterized protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BSU40820 (yyaL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thioredox_DsbH Thioredoxin_7 Glyco_hydro_76 Glyco_hydro_88 GlcNAc_2-epim LANC_like Thioredoxin_2 Pectate_lyase_2 Toprim
Motif
Other DBs
NCBI-GeneID: 937904
NCBI-ProteinID: NP_391962
Pasteur: BG10040
BSORF: BG10040
UniProt: P37512
LinkDB All DBs
Position
4191198..4193267
Genome map
AA seq 689 aa AA seqDB search
MPNKSKPNRLINEKSPYLLQHAHNPVDWFPWGEEAFEKAKRENKPVLVSIGYSTCHWCHV
MAHESFEDEEIARLLNERFVAIKVDREERPDVDSVYMRICQLMTGQGGWPLNVFITPDQK
PFYAGTYFPKTSKFNRPGFVDVLEHLSETFANDREHVEDIAENAAKHLQTKTAAKTGEGL
SESAIHRTFQQLASGFDTIYGGFGQAPKFPMPHMLMYLLRYDHNTGQENALYNVTKTLDS
MANGGIYDHIGYGFARYSTDDEWLVPHFEKMLYDNALLLTAYTEAYQVTQNSRYKEICEQ
IITFIQREMTHEDGSFFSALDADTEGEEGKYYVWSKEEILKTLGDDLGTLYCQVYDITEE
GNFEGKNIPNLIHTKREQIKEDAGLTEKELSLKLEDARQQLLKTREERTYPHVDDKVLTS
WNALMIAGLAKAAKVYQEPKYLSLAKDAITFIENKLIIDGRVMVRYRDGEVKNKGFIDDY
AFLLWAYLDLYEASFDLSYLQKAKKLTDDMISLFWDEEHGGFYFTGHDAEALIVREKEVY
DGAVPSGNSVAAVQLLRLGQVTGDLSLIEKAETMFSVFKPDIEAYPSGHAFFMQSVLRHL
MPKKEIVIFGSADDPARKQIIAELQKAFKPNDSILVAEQPEQCKDIAPFAADYRIIDGKT
TVYICENFACQQPTTNIEEAIHTLISSRD
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atgccaaacaaaagtaaacccaatagattaatcaatgagaaatcaccatatttactccaa
cacgcccacaaccctgtggactggttcccgtggggagaagaagcttttgaaaaagcaaaa
cgcgaaaacaagccggttctggtcagcatcggttattcgacttgtcattggtgccacgtg
atggcccacgaaagctttgaagacgaagaaatcgcgcgtcttctcaatgaacggtttgtg
gcgattaaagtcgaccgggaagagcggcctgatgtggattctgtttatatgagaatctgc
cagctgatgaccgggcagggcggctggccgctgaatgtgtttatcacgcctgatcaaaag
ccgttttacgcgggtacatattttccaaagacgagcaaattcaatcgtcccggttttgtt
gatgtgcttgagcatctgtctgagacgtttgcgaacgaccgcgagcatgtcgaggatatt
gcggagaacgccgctaaacatttgcagaccaaaacagctgcaaaaactggtgagggcctt
agcgaatcagcgattcaccggacattccagcagcttgccagcgggtttgacacgatctac
ggcggtttcgggcaggcaccgaaatttccaatgcctcatatgctgatgtatttgctacgt
tatgatcacaatacagggcaggagaacgctctatacaacgtgacgaaaacattggacagc
atggcgaatggcggcatttacgatcatatcggctatgggttcgcccgctattcgaccgat
gacgagtggctcgttccccactttgaaaaaatgctgtacgacaatgcgctgctgctgacc
gcttatacagaagcctatcaggtcacgcaaaacagccgctataaagagatttgtgagcag
atcattacgttcattcagagggaaatgactcatgaagacggaagctttttctcggctttg
gacgcggacacagaaggagaagaaggaaagtactacgtgtggtcaaaggaagagattcta
aaaacgctcggggacgatctcggaacgctgtattgccaagtgtatgacatcactgaagaa
ggaaactttgaaggcaaaaatattcctaacctcattcacacaaagcgagaacaaatcaaa
gaggatgccgggttaaccgaaaaagagctcagtctcaaactcgaagacgcaagacagcag
ctcttgaagacacgcgaggaaagaacctatccgcatgtcgatgataaagtgcttacctca
tggaacgcgctgatgatcgcgggtcttgcgaaagcggcaaaggtataccaggagccgaaa
tatctcagcctagcgaaagacgccatcacatttattgaaaacaaattaatcatcgacggc
cgtgtgatggtccgatatcgtgatggcgaagtgaaaaacaaaggctttatcgacgattac
gcttttctcctatgggcttatctggatctctatgaagcttcgtttgatctttcttattta
caaaaagcgaagaaactgacagacgatatgatcagcttattttgggatgaggagcatggc
ggattctacttcaccggacacgatgcagaagccttaatcgtacgggaaaaagaagtgtac
gacggcgccgtgccttcaggaaacagtgtggcagctgttcagctgctgcgtctcgggcaa
gtcacaggcgacttatcactgatcgaaaaagcggaaacaatgttttccgtgttcaagcca
gacatagaagcgtatccgagcggccatgctttctttatgcaaagtgtgttaaggcatctg
atgcctaaaaaagaaatcgtgatttttggcagcgcagacgatccagccagaaaacaaatt
atagcggagcttcaaaaagcctttaagcccaacgactccattctggtggcagagcagccc
gagcaatgcaaagacattgcgccatttgcagcagactaccgcatcatagacggcaaaaca
accgtttatatttgtgaaaacttcgcctgccagcaaccgacaacaaatattgaagaagcg
atccacacattaataagcagcagggattaa

DBGET integrated database retrieval system