KEGG   Brucella suis bv. 2 Bs364CITA: BSSP2_I1730Help
Entry
BSSP2_I1730       CDS       T03741                                 

Gene name
sucA
Definition
(GenBank) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
bsuc  Brucella suis bv. 2 Bs364CITA
Pathway
bsuc00020  Citrate cycle (TCA cycle)
bsuc00310  Lysine degradation
bsuc00380  Tryptophan metabolism
bsuc01100  Metabolic pathways
bsuc01110  Biosynthesis of secondary metabolites
bsuc01120  Microbial metabolism in diverse environments
bsuc01130  Biosynthesis of antibiotics
bsuc01200  Carbon metabolism
Module
bsuc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bsuc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bsuc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BSSP2_I1730 (sucA)
  09105 Amino acid metabolism
   00310 Lysine degradation
    BSSP2_I1730 (sucA)
   00380 Tryptophan metabolism
    BSSP2_I1730 (sucA)
Enzymes [BR:bsuc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     BSSP2_I1730 (sucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: AIB31932
LinkDB All DBs
Position
I:complement(1667448..1670462)
Genome map
AA seq 1004 aa AA seqDB search
MAKQEQAPDRANDVFALTSFLYGGNADYIEELYAKYEDDPNSVDPQWRDFFAKLGDNADD
VKKNAEGPSWTRKNWPIAANGELVSALDGNWAEVEKHVTDKLKGKAAKGEAKGAAGTPLT
AEEITQAARDSVRAIMMIRAYRMRGHLHANLDPLGLAEKPNDYNELEPENYGFTPADYNR
KIFIDNVLGLEYATVPEMLDILKRTYCGAIGVEFMHISDPAEKAWIQERIEGPDKKVAFT
PEGKKAILSKLIEAEGFEQFIDVKYKGTKRFGLDGGESLIPALEQIVKRGGQMGLKEVVL
GMAHRGRLNVLSQVMGKPHRAIFHEFKGGSYTPDDVEGSGDVKYHLGASSDREFDGNKVH
LSLTANPSHLEIVNPVVMGKARAKQDLLVGRTRDDMVPLSERAKVLPLLLHGDAAFAGQG
VVAECLGLSGLKGHRVAGTLHFIINNQIGFTTNPAFSRSSPYPSDVAKMIEAPIFHVNGD
DPEAVVFAAKVATEFRMTFHKPVVIDMFCYRRFGHNEGDEPSFTQPLMYKAIRAHKTTVQ
LYGEKLIAEGLVTQDDIDRMKADWRQKLEGEFEAGQSYKPNKADWLDGAWAGLRTADNAD
EQRRGKTAVPVKTLKEIGKKLVEVPKDFHVHRTIQRFLDNRAKMMETGEGIDWATAESLA
FGSLAVEGHPIRLSGQDVERGTFSQRHTVLYDQENQNRYIPLNNLQKGQAIYEAINSMLS
EEAVLGYEYGYSLSDPRALVLWEAQFGDFANGAQVVFDQFISSGERKWLRMSGLVCLLPH
GFEGQGPEHSSARLERYLQLCAEDNMQVANVTTPANYFHILRRQMKRDFRKPLIMMTPKS
LLRHKRAISTLAELSGESSFHRLLWDDAQYNKDEGIKLQKDAKIRRVVLCSGKVYYDLYE
EREKRGIDDVYLLRVEQLYPFPAKALINELSRFRHAEMVWCQEEPKNMGAWSFIDPYLEW
VLAHIDAKHQRVRYAGRPAAASPATGLMSKHLAQLAAFLEDALG
NT seq 3015 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagcaagaacaagccccagatcgggccaacgacgttttcgcccttacctcattc
ctctatggcggcaatgccgactatatcgaggaactgtacgccaaatatgaggacgatccg
aattcggtcgatccgcagtggcgcgatttcttcgcgaagctgggcgataatgccgacgac
gtgaagaaaaatgcggaagggccatcctggaccagaaagaactggccgattgctgccaat
ggcgaacttgtttccgcactcgacggcaactgggccgaagttgaaaagcatgtcaccgac
aagctgaagggcaaggctgcgaagggtgaagccaagggcgctgcgggcacgccgctcacc
gccgaagagatcacacaggctgcgcgcgacagcgtgcgcgccatcatgatgatccgcgcc
tatcgcatgcgcggccatctgcacgccaatctcgacccgctcggccttgccgaaaagccg
aacgactataacgagctggagccggaaaattacggtttcacgcctgccgactataaccgc
aagatcttcatcgacaacgtgctcggcctcgaatatgcgaccgtgccggaaatgctcgac
atcttgaagcgcacctattgcggcgcgattggggtcgaattcatgcatatttccgatccg
gctgaaaaggcctggattcaggaacgcatcgaaggcccggacaagaaggttgccttcacg
ccggagggcaagaaggccatcctgtccaagctcatcgaggcggaaggcttcgagcagttc
atcgatgtcaagtataagggcaccaagcgtttcggtcttgatggcggcgaatcgctgatc
cccgcgcttgagcagatcgtcaagcgcggcggccagatgggtctcaaggaagtcgtgctc
ggcatggcgcaccgtggccgcctcaacgtgctgagccaggtcatgggcaagccgcaccgc
gccattttccatgagttcaagggcggttcctatacgccggacgatgtggaaggttcgggc
gatgtgaagtaccatctgggcgcttcctccgaccgtgaattcgacggcaacaaggttcac
ctgtcgctgacggccaatccgtcgcatcttgaaatcgtcaatccggtggtgatgggcaag
gcccgcgccaagcaggacctgcttgtgggccgcacccgcgacgacatggtgccgctttcc
gaacgcgccaaggttctgccgctgctgctgcatggcgatgcggcctttgccggtcagggc
gtcgtggcggaatgcctcggcctttccggcctgaagggacaccgtgttgccggtacgctg
catttcatcatcaacaaccagatcggtttcaccaccaatccggccttctcgcgttcttcg
ccttatccgtccgatgtggcgaagatgatcgaagcgccgatcttccacgtcaatggcgac
gacccggaagcggtggtctttgcagccaaggtggcgaccgaattccgcatgaccttccac
aagccggtggtcatcgatatgttctgctatcgccgcttcggccacaatgaaggcgacgag
ccgtccttcacccagccgttgatgtacaaggcgattcgtgcgcacaagaccacggttcag
ctttatggcgagaagctgatcgccgaaggcctggtcacgcaggacgatatcgaccggatg
aaggccgactggcgccagaagctcgaaggcgagttcgaggccggccagagctacaagccg
aacaaggccgactggcttgacggtgcgtgggctggcctgcgcaccgcagacaatgcggat
gaacagcgccgcggcaagacggctgtgccggtgaagacgctcaaggaaatcggcaagaag
ctcgttgaagtgccgaaggatttccatgtccatcgcacgatccagcgtttcctcgacaac
cgtgccaagatgatggaaacgggtgaggggatcgactgggcgacggctgaatcgctggcg
ttcggttcactggccgttgaaggtcatccgatccgcctgtcgggacaggacgtcgagcgc
ggtactttctcgcagcgccatacggttctttacgatcaggaaaaccagaaccgctacatc
ccgctgaacaatcttcagaagggacaggcgatctacgaagccatcaattcgatgctctcg
gaagaagccgtcctcggctacgaatacggctattcgctgtctgacccgcgcgcgcttgtt
ctgtgggaagcccagtttggtgacttcgccaatggtgcgcaggtcgtgtttgaccagttc
atctcgtcgggcgaacgcaagtggctgcgtatgtctggtctcgtctgccttctgccgcat
ggttttgaaggtcaggggccggaacactcctcggcgcgtctggaacgttatctccagctt
tgtgcggaagacaatatgcaggtggcaaacgtcacgacgcctgccaactacttccacatt
ctgcgtcgccagatgaagcgcgacttccgcaagccgctcatcatgatgacgccgaagtcg
ctgctgcgccacaagcgcgcaatctcgacgctggccgagctttcgggcgaatcctcgttc
caccgcctgctgtgggacgatgcgcagtacaacaaggatgaaggcatcaagctccagaag
gatgccaagatccgccgcgtcgtgctctgttcgggcaaggtctattacgacctttacgaa
gaacgcgagaagcgcggcatcgacgatgtctatctgctgcgtgtcgagcagctctatccg
ttcccggccaaggcgctcatcaacgagctgtcgcgcttccgtcatgcggaaatggtctgg
tgccaggaagagccgaagaacatgggcgcatggtcgttcatcgacccgtatctggagtgg
gtactggcgcatatcgacgccaagcaccagcgcgtgcgctatgcgggccgtccggccgcc
gcatcgcctgcaacgggcctgatgtcgaagcaccttgcgcagcttgccgctttccttgag
gatgcgcttggctga

DBGET integrated database retrieval system