KEGG   Brucella suis bv. 2 Bs364CITA: BSSP2_II0679Help
Entry
BSSP2_II0679      CDS       T03741                                 

Gene name
gcvT
Definition
(GenBank) Aminomethyltransferase (glycine cleavage system T protein)
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
bsuc  Brucella suis bv. 2 Bs364CITA
Pathway
bsuc00260  Glycine, serine and threonine metabolism
bsuc00630  Glyoxylate and dicarboxylate metabolism
bsuc00670  One carbon pool by folate
bsuc01100  Metabolic pathways
bsuc01110  Biosynthesis of secondary metabolites
bsuc01130  Biosynthesis of antibiotics
bsuc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bsuc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BSSP2_II0679 (gcvT)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BSSP2_II0679 (gcvT)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    BSSP2_II0679 (gcvT)
Enzymes [BR:bsuc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     BSSP2_II0679 (gcvT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C SoxG
Motif
Other DBs
NCBI-ProteinID: AIB32869
LinkDB All DBs
Position
II:complement(671745..672848)
Genome map
AA seq 367 aa AA seqDB search
MGDTAHLNTLPLQDLHEKAGARFGGFAGWNMPITYPLGVMKEHLHTRDHAGLFDISHMKL
VEVSGADAAALLAETCPLDPTILKTGQSKYTFFLNDNGGVLDDLIVTRLGEDRFMVVANA
GNADADIEHLNEAASGKAVKVNPLDRVFLALQGPEAEAVITDAGLPGADLAFMSGFEPKQ
GWFMTRSGYTGEDGFEIGLPADEARALAEKLLADERVEWIGLAARDSLRLEAGLCLHGQD
ITPETDPVSAGLTWAITKAVREKAAFNGAKAVLDAIAKGASAKRVGLKPEGRQPVRAGAD
LFDESGRQIGTVTSGGFGPSAGFPVAMGYVEASLATPGTRVFADVRGNKVPVDVHALPFT
PHRYRKG
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgggcgataccgcacatttgaataccctgccgttgcaggatctgcatgaaaaggctggc
gcgcgcttcggcggctttgccggctggaacatgccaatcacctatccgctgggtgtgatg
aaggaacatcttcatacgcgcgaccatgcgggcctcttcgacatttcccacatgaagctg
gtggaagtttccggcgcggatgccgccgcgcttctcgccgagacctgcccgctcgatccg
acgatcctgaagacgggccagtcgaaatatacgttcttcctcaatgataatggcggcgtg
ctggatgatctcatcgtcacgcgccttggcgaagaccgtttcatggttgttgccaatgcg
ggcaatgccgatgccgacatcgagcatctcaatgaagccgcgtcgggcaaggccgtaaag
gttaatccgctcgaccgtgttttccttgctttgcaggggccggaagcagaagctgtcatc
accgatgccggtctgccgggcgccgatcttgccttcatgagcggtttcgagccgaaacag
ggctggttcatgacccgttcgggctataccggcgaagacggtttcgagattggcctgcct
gccgatgaagcccgtgcgctggccgaaaagcttcttgccgatgaacgtgtcgaatggatc
ggccttgccgcccgcgattccttacgcctcgaagcgggcctctgcctgcacggtcaggac
atcacgccggaaaccgatccggtttcggctggcctcacctgggcgatcactaaggctgtg
cgcgaaaaagccgccttcaacggcgcgaaagccgttctcgacgccattgccaaaggcgcc
agcgccaagcgcgtcggcctcaagccggaaggccgccagccggtgcgcgccggggccgac
cttttcgacgaaagtggccgccagatcggcaccgtcacctcgggcggctttggcccttcc
gccggtttcccggtcgccatgggctatgtcgaggcaagcctcgccacccccggcacccgt
gtttttgcagatgttcgcggcaacaaggttcccgttgacgtccacgcacttcccttcaca
ccgcatcgctatcgcaaaggatga

DBGET integrated database retrieval system