KEGG   Brucella suis bv. 2 Bs143CITA: BSSP1_I0199Help
Entry
BSSP1_I0199       CDS       T03367                                 

Definition
(GenBank) Aldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
bsui  Brucella suis bv. 2 Bs143CITA
Pathway
bsui00010  Glycolysis / Gluconeogenesis
bsui00620  Pyruvate metabolism
bsui01100  Metabolic pathways
bsui01110  Biosynthesis of secondary metabolites
bsui01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bsui00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BSSP1_I0199
   00620 Pyruvate metabolism
    BSSP1_I0199
Enzymes [BR:bsui01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     BSSP1_I0199
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AIB27071
LinkDB All DBs
Position
I:205935..207452
Genome map
AA seq 505 aa AA seqDB search
MNKVEFSRTVKPAFAKRYGNFIGGKWVEPRSGRYFENTSPVNGQVLCEVARSDAADVEAA
LDAAHAARELWGRTSVAERALILNRIADRIEENLPALAAAETWDNGKPIRETTNADLPLA
VDHFRYFAGVTRAQEGGISEIDHDTVAYHFHEPLGVVGQIIPWNFPLLMATWKLAPALAA
GNCVVLKPAEQTPASILVLMELIADILPPGVVNIVNGFGLEAGKPLASSPRIAKIAFTGE
TTTGRLIMQYASQNLIPVTLELGGKSPNIFFKDVAAEDDDFLDKAIEGFVMFALNQGEVC
TCPSRALIQESIYDRFMEKALKRVEAIVQGDPLDPATMIGAQASSEQLEKILSYLDIGRQ
EGAEVLAGGERNMLPGDLAGGYYVKPTVFKGHNKMRIFQEEIFGPVVSVATFKDDTEALS
IANDTLYGLGAGIWTRDGTRAYRFGRAIKAGRVWTNCYHAYPAHAAFGGYKQSGIGRENH
LKMLDHYQNTKNMLVSYSPKKLGFF
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaggttgaattcagccggaccgtgaaaccggcttttgcaaaacgctatggcaat
ttcatcggcggcaaatgggtggaacccaggtcaggccgctattttgagaatacatcgccc
gtaaacggccaggttctgtgtgaagtggcccgttccgatgctgccgatgtggaagcggcg
ctcgatgcagcgcacgccgccagggagctatggggcaggacaagcgtggctgaacgcgcg
cttatcctcaatcgcatcgcagaccggattgaggaaaacctgcctgcattggcggctgcc
gaaacatgggacaacggcaagccgatccgcgaaaccaccaatgccgacctgccgctggcg
gttgatcatttccgctatttcgcgggcgtcacccgcgctcaggaaggcggtatttctgaa
atcgatcacgatacggtcgcctatcacttccacgaaccgctgggcgtggtggggcagatc
attccgtggaacttcccgcttctcatggcgacatggaagcttgcgccagcccttgccgca
ggcaattgcgtggtgctgaaacccgccgaacaaactccggcttccatcctcgtgctgatg
gagctcattgccgatattctgccgccgggtgtggtcaatatcgtcaatggtttcggcctt
gaggccggtaagccgctggcatccagcccccgcatcgccaagatcgccttcacgggtgag
acgacgaccggccgcctcatcatgcaatatgccagccagaacctcatcccggtcacgctg
gagctgggcggcaagtcacccaacatcttcttcaaggatgtcgcggctgaagatgatgat
tttctggacaaggccattgaaggcttcgtgatgttcgcgctcaatcagggcgaggtctgt
acttgccccagccgcgcgctcattcaggaatcgatctatgacaggttcatggaaaaggcg
ctgaagcgtgttgaagccatcgtgcagggcgatccgcttgacccggccacgatgattggc
gcgcaggcatcgagcgaacaactcgaaaaaatcctgagctatctcgatattggccgtcag
gaaggtgcggaagtgctggcaggtggcgaacgcaacatgctgccgggcgatcttgctggc
ggctattatgtgaagccgaccgtcttcaagggccataacaagatgcgcattttccaggag
gaaatcttcgggccggtcgtgtccgtcgcaaccttcaaggatgatacggaggcgctatcg
attgccaatgacacactctatggcctcggtgcgggcatatggacgcgcgatggcacacgc
gcctatcgcttcggtcgcgccattaaggcaggccgcgtctggaccaactgctaccacgcc
tacccggcccatgcggctttcggtggttacaagcagtcggggatcgggcgcgagaaccat
ctgaagatgctcgatcactaccagaataccaagaacatgctggtgagctacagccccaag
aagcttggcttcttctaa

DBGET integrated database retrieval system